KEGG   Gordonia polyisoprenivorans: GPOL_c16080Help
Entry
GPOL_c16080       CDS       T01719                                 

Definition
(GenBank) putative cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00984  Steroid degradation
gpo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    GPOL_c16080
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     GPOL_c16080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO GMC_oxred_N GMC_oxred_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Fer4_9 Fer4_8 Pyr_redox Fer4 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFA72657
UniProt: H6MTH3
Position
1828757..1830523
Genome map
AA seq 588 aa AA seqDB search
MAAHHGSPDFDVLIIGSGFGGSVSALRLVEKGYRVGVVEAGRRFDDEDFAKTSWRLNKWL
WAPKLGLYGIQRIHALKDVMILAGAGVGGGSLNYANTLYKPPTPFFTDPQWNHITDWEDE
LSPYYDQARRMLGVVTNPTFTESDRIMREVADEMGVGDTFTSTPVGVFFGEKVGLAGRPG
QTVPDPYFGGAGPERTACTECGACMTGCRVGAKNTLMKNYLGLAERHGATIIDRTTVDGL
SRRADGTWEVSTHGSSSWGPLGRRSRTYTASQVVVAAGTFNTQRLLHHAKERTLPAISDA
MGRLTRTNSESILGANAAKYDPRHDYSHGVAITSSFHPEPNTHIEPVRYGKGSNAIAYLQ
TLLTDGGTPAQRFGQFLRAVARNPFLLARILVVHKWSQRTVIALVMQNNNNSLTTFVRKR
GPLRYITSKQGIGEPNPTWIPKGNEATRRIADKLPGGMAGGTWGDIVNMPLTAHYLGGCA
ISDDPANGVIDPYHRVWNYPTLHITDGASISANLGVNPSLSICAQAERAMAFWPNKGEID
TRPEQGVGYTRLQPVVPVAPVVPADAPGALRLPITPVERAELPAAPGA
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccaccatggttcacccgacttcgacgtgctcatcatcggttccggcttcggc
ggcagcgtcagcgcgttacgcctggtcgagaaggggtatcgcgtcggcgtcgtcgaagcg
ggtcgccgcttcgacgacgaggacttcgccaagaccagctggcggctcaacaagtggctc
tgggcacccaagctcggcctgtacggcattcagcgcatccacgccctcaaggacgtgatg
attctggccggtgcgggcgtcggcggcgggtcgctcaattacgcgaacaccctgtacaag
ccgcccaccccgttcttcaccgatccccagtggaatcacatcaccgactgggaggacgaa
ctgtcgccgtactacgatcaggcgcggcggatgctcggggtggtcaccaatccgacgttc
accgaatccgaccgcatcatgcgtgaggtcgccgacgagatgggtgtcggcgacaccttc
acctcgaccccggtcggtgtgttcttcggagagaaggtcggtctggccggtcgtcccgga
cagaccgtccccgacccgtacttcggcggggccggacccgagcgcaccgcgtgcaccgaa
tgcggcgcctgtatgaccgggtgccgggtcggcgccaagaacaccctgatgaagaactac
ctggggctggccgaacgccacggggcgacgatcatcgaccgcacgaccgtcgacggactg
tcccggcgcgccgacggtacctgggaggtgagcacgcatgggtcgtcgtcgtgggggccg
ctgggccgacgtagccgcacctacaccgcgtcgcaggtggtcgtcgcggcgggcaccttc
aacacccagcgtctgctccaccacgccaaggagcgcaccctgcccgcgatctcggatgcc
atggggcgtctgacccgcaccaactccgagtcaatcctcggcgccaatgcggcgaaatac
gatccccggcacgactattcacacggtgtcgcgatcacctcgtcgttccatccggagccg
aacacgcacatcgaacccgtccggtacggcaagggctccaacgccatcgcctatctgcag
acgctgctcaccgacggtggcaccccggcccaacgattcggacagttcctgcgtgcggtg
gcccgcaatccgttcctgctcgcccggattctggtggtgcacaagtggagtcagcgcacc
gtgatcgcgctggtgatgcagaacaacaacaattcgctgacgaccttcgtccgcaaacgc
ggacccctgcgctacatcaccagcaagcagggcatcggcgagcccaatccgacctggatt
cccaagggcaacgaggccacccgccggatcgccgacaaactcccgggcgggatggccggc
ggcacgtggggcgacatcgtcaacatgccgctgaccgcccactatctcggtgggtgcgcc
atctccgacgatccggccaacggtgtcatcgacccctatcaccgcgtctggaactacccg
acgctgcacatcaccgacggtgcgtcgatctcggccaatctcggggtcaatccgtcgttg
tcgatctgtgcccaggccgagcgcgcgatggcgttctggcccaacaagggtgagatcgac
acccggccggaacagggtgtgggatacacgcgactgcaaccggtggtacctgttgcgccc
gtggtacccgcggatgcgcccggggcgctgcgattgccgatcacgccggtcgagcgggcc
gaattgcctgcggcgccgggagcgtag

DBGET integrated database retrieval system