KEGG   Gordonia polyisoprenivorans: GPOL_c16650Help
Entry
GPOL_c16650       CDS       T01719                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GPOL_c16650 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GPOL_c16650 (sdhD)
   00650 Butanoate metabolism
    GPOL_c16650 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    GPOL_c16650 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1890280..1890732)
Genome map
AA seq 150 aa AA seqDB search
MTASSPHLAKTLGTDYDRPASLDNPRAPRARKGGNFEKYAWLFMRFSGLALIILTIGHMF
IMLAWDNGVHRIDASFVAARWKEPFWQIWDLTMLWLAQLHGGNGVRTVIADYSRKDSTRF
WLNVLLGISMILVLVLGTYALLTFDVNSVN
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatcctccccacacctggccaagacgctcggcaccgactacgaccggccggcc
agcctcgacaatccgcgcgcgccgcgtgcccgcaagggcggcaacttcgagaagtacgcg
tggctgttcatgcgcttctccggcctggcgctgatcatcctgaccatcgggcacatgttc
atcatgttggcctgggacaacggtgtgcaccgcatcgacgcctccttcgtggcggcgcgg
tggaaggaacccttctggcagatctgggacctgacgatgctgtggctggcccagttgcac
ggcggcaacggtgtgcgcaccgtcatcgccgactactcgcgcaaggactccacccggttc
tggctcaacgtgctgctcgggatctcgatgatcctcgtgctggtgctcggtacctacgcg
cttctgacctttgacgtcaacagcgtcaactga

DBGET integrated database retrieval system