KEGG   Gordonia polyisoprenivorans: GPOL_c16680Help
Entry
GPOL_c16680       CDS       T01719                                 

Gene name
deoA
Definition
thymidine phosphorylase DeoA (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gpo00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1891819..1893165
Genome map
AA seq 448 aa AA seqDB search
MNPEIIDPISVIATKRDGGSLSDGQIRWVVDGYTRGSVAPEQMSALLMAIVLRGMDRREI
ATWTQAMIDSGRRADFGDLRRDGRSLRTVDKHSTGGVGDKITLPLAPLVASYGVAVPQLS
GRGLGHTGGTLDKLESISGWRADLSMDEILSQLEAVGAVVCAASPDLAPADRLLYALRDI
TGTVASIPLIASSIMSKKIAEGTGALVLDVKVGSGAFLPELDSARELATTMVELGHRAGV
ATSALLTDMDTPLGRCAGNAVEVAESLEVLAGGGPADVVELTVALAREMLAAAGISDVDP
ADHLRNGRAMDSWRAMIAAQGGDPDAPLPRARHTDVVVAETSGRVRRLDARAVGDAAWRL
GAGRSVPGESVQSEAGVQWHTRPGEFVEAGAALFTLHTATPERFGPARAALVGAVDIAAE
PNSGGPGAELDPADVARPLVIEHVRFGS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgagatcatcgatccgatctcggtgatcgccaccaaacgcgacggcggttcg
ctgagcgacggccagatccggtgggtcgtcgacggctacacgcggggatcggtcgcgccg
gagcagatgtcggcgttgctgatggcgatcgtgctgcgcggcatggaccgtcgtgagatc
gccacctggacgcaggcgatgatcgacagcgggcggcgcgcggacttcggcgatctgcgc
cgcgacggtcggtcgcttcgcaccgtcgacaagcattccaccggcggggtgggggacaag
atcaccctgccgctcgcgcccctggtggcctcgtatggtgttgcggtgccccaactgtcg
ggccgaggcctcgggcacaccggcggcacgctggacaagctggagtccatctcgggatgg
cgtgcggacctgtcgatggacgagatactcagccagctcgaggcggtgggtgcggtggtc
tgcgcggcgagtcccgaccttgcacccgccgatcgtctgctctatgcgttgcgggacatc
accggcaccgtcgcatcgatcccgttgatcgccagctcgatcatgagcaagaagatcgcc
gagggcaccggcgcgctggtgctcgacgtcaaggtcggctcgggggcgttcctccccgaa
ctcgactccgcccgcgaactcgcgaccaccatggtcgagctcggacatcgtgccggggtg
gcgacctcggcgctgctgaccgacatggacaccccgctcggacgctgcgcgggcaacgcc
gtcgaggtcgccgaatcgctcgaggtgctcgccggcggcgggcccgccgacgtcgtcgag
ctgacggtggccctggcgcgggagatgctcgccgcagccgggatctccgacgtcgaccct
gccgaccatctgcgcaacggccgcgccatggactcctggcgcgcgatgatcgccgcgcag
ggcggcgacccggatgcaccgctgccgcgggcccggcacaccgatgtcgtcgtcgccgag
acgtcgggtcgtgtgcgacggctggatgcgcgagcggtcggcgacgccgcctggcgactg
ggtgccgggcggtcggtgcccggtgagtccgtgcagtccgaggccggggtgcagtggcac
acgcgtcccggagagttcgtcgaggcgggtgcggcgctgttcacgctgcacaccgcaaca
ccggaacggttcggtcccgcgcgggcggcgttggtcggggcggtcgacattgccgccgag
ccgaactccggcggccccggtgccgaactcgatcccgctgatgtcgcccggccgctggtg
atcgaacacgttaggttcggatcatga

DBGET integrated database retrieval system