KEGG   Gordonia polyisoprenivorans: GPOL_c17910Help
Entry
GPOL_c17910       CDS       T01719                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase ThrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GPOL_c17910 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GPOL_c17910 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GPOL_c17910 (thrC)
Enzymes [BR:gpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GPOL_c17910 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2033761..2034822
Genome map
AA seq 353 aa AA seqDB search
MHSGWPGLIEAYRSRLPVADDWKVITLLEGATPLVAAPYLSELTGCEVYLKVEGLNPTGS
FKDRGMTMAVSNAVNNGKTAVLCASTGNTSASAAAYATRAGITCAVLIPQGKIAMGKLAQ
AVMHGAKIIQVQGNFDDCLELARKATAEFTEIELVNSVNPARIEGQKTAAFEIVDVLGRA
PDVHALPVGNAGNITAYWKGYSEYHTDGIASSRPRMLGVQAAGAAPLVSGEPVADPETIA
TAIRIGNPASWHQAVAAKDESGGQFRAATDEKLLEAYRLVAGREGVFVEPASAASVAGLL
AAREEGWVRAGETVVCTVTGNGLKDPDTALSGMPEVEAIDVDPVAVAHALGVA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcattcggggtggcccggactcatcgaggcctaccggtcgcggttgccggtcgccgac
gactggaaggtgatcaccctgctcgagggtgcgaccccgctcgttgcggcgccgtatctc
tcggagctcaccggctgcgaggtgtacctcaaggtggagggtctgaatccgaccgggtcg
ttcaaggaccgcggtatgaccatggccgtctccaacgcggtcaacaacggcaagaccgcg
gtgctgtgcgcgtccaccggcaacacctcggcgtcggcggccgcctacgccacccgcgcc
gggatcacctgtgcggtgctgatcccgcagggcaagatcgcgatgggcaagctcgcgcag
gcggtcatgcacggcgccaagatcattcaggtgcagggcaacttcgacgactgtctggag
ctcgcccgcaaggcgaccgccgaattcaccgagatcgagctcgtcaactcggtcaacccg
gcccgcatcgaggggcagaagaccgcggccttcgagatcgtcgacgtcctcggccgcgct
cctgatgtccatgcgttgccggtcggcaacgccggcaacatcaccgcctactggaagggc
tactcggagtaccacaccgacgggatcgcctcgtcgcgtccgcgcatgctcggtgtccag
gcggccggcgcggcgccgctggtcagcggggagcccgtggccgacccggagaccatcgcc
accgcgatccggatcggtaacccggccagctggcatcaggccgtggccgccaaggacgaa
tccggcgggcagttccgcgccgccaccgacgagaagttgctcgaggcctaccgtctcgtc
gcgggccgcgagggtgtcttcgtcgaacccgcgtcggcggccagtgtcgcgggcctgctc
gccgcgcgtgaggagggctgggtgcgtgccggggaaaccgtcgtgtgcaccgtgaccggc
aacggactcaaggatcccgacaccgcgttgtcggggatgcccgaggtggaagcgatcgac
gtcgacccggtggcggtggcccatgccctcggcgtcgcctga

DBGET integrated database retrieval system