KEGG   Gordonia polyisoprenivorans: GPOL_c18370Help
Entry
GPOL_c18370       CDS       T01719                                 

Gene name
glsA
Definition
(GenBank) glutaminase GlsA
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00220  Arginine biosynthesis
gpo00250  Alanine, aspartate and glutamate metabolism
gpo00471  D-Glutamine and D-glutamate metabolism
gpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GPOL_c18370 (glsA)
   00220 Arginine biosynthesis
    GPOL_c18370 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GPOL_c18370 (glsA)
Enzymes [BR:gpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     GPOL_c18370 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase STAS
Motif
Other DBs
NCBI-ProteinID: AFA72882
UniProt: H6MW68
Position
2090244..2091680
Genome map
AA seq 478 aa AA seqDB search
MPISHVHGYLRHIMDECAPDRSGAVADYIPELAAVDADGYALSMCMHDGNTYSLGDVGVE
FTIQSVSKPLTYALALTRLDVAEVDGKIGVEPSGEAFNEISVDERRRPRNPMINAGAILA
SSMLLPPVRSLPAGAVDKAFDELVEFYSGCAGRHLTIDEQVYASEAATGSRNRAIVYMLD
SFGAVDTDPEAALDLYFRQCSLRVTSDDLAAIAATIAAGGVNPRTGRRVLSNEVAQRLLS
VMTTCGMYDGAGDWVTSVGLPAKSGVGGGILAVLPGQLGIGVYSPRLDQHGNSVRGVDTC
RRLSRDLGLHMFNVTRESRVSIRSVYSIGEFEVGADWDELQRSYLRTCRDRVRVYELQGD
LTFAGAERALRRIESDLDDLDVAIVEISRVGVIDPVARTMLLGIKHTTDVRGQRAMLVDP
DGVVRESVDSHRSDFVVPNLNAPEQLRGLDPTLPHVHSTMEAAVRDAEEFQLESFRRP
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgccgatctcccatgtccacggatacctgcgccacatcatggatgaatgcgcgcccgat
cgttccggagcggttgccgactacatccccgaactcgccgccgtcgacgccgatggctac
gccctgtcgatgtgcatgcacgacggcaacacctattcgctcggtgacgtcggcgtcgag
ttcaccatccaatcggtgtccaagccgctcacctatgcgctcgcgctgacccgcctcgat
gtggcggaggtggatgggaagatcggcgtcgagccgtcgggtgaggcgttcaacgagatc
agcgtggacgagcggcgccgtccgcgtaatccgatgatcaatgccggcgcgatcctggcg
tcgtcgatgctgttgccgccggtccggtcgctgccggccggtgccgtggacaaggcgttc
gacgaactcgtcgagttctactccggttgcgccgggcgacatctgacgatcgatgagcag
gtctacgcctccgaggccgccaccggttcccgtaatcgcgccatcgtctacatgctcgac
agtttcggcgcggtcgacaccgaccccgaggcggccctcgacctctacttccgtcaatgt
tcgctgcgggtgaccagcgacgacctcgccgcgatcgccgcgacgatcgccgcgggcggg
gtcaatccgcgcaccggtcggcgggtgctgagcaacgaggtggcccagcggctgttgagt
gtgatgaccacgtgcggcatgtacgacggcgcaggggactgggtcacctcggtgggtctg
ccggccaagagcggggtcggtggcggcattctggcggtgctccccggccaactcgggatc
ggtgtgtactcaccgcgcctcgatcagcacggcaacagcgtccgcggtgtcgatacctgt
cgccggttgtcccgcgacctgggcctgcacatgttcaatgtgacgcgcgagagccgggtg
tccatccggtcggtgtactcgatcggtgagttcgaggtcggcgcggactgggacgaactg
cagcgcagttacctgcgaacctgtcgcgaccgggtacgggtatatgaactgcagggggat
ctgaccttcgccggcgccgagcgtgccctgcgtcgcatcgagtccgatctcgacgacctc
gatgtcgcaatcgtcgagatctcgcgcgtcggggtgatcgatccggtcgcccggacgatg
ctgctcggtatcaaacacaccaccgatgtgcgcgggcagcgcgccatgctcgtcgatccc
gatggcgtggtacgggagagcgtggacagtcatcgctccgacttcgtggtgccgaatctg
aatgcgcccgaacaactccggggtctcgatcccaccctgccgcacgtgcactcgacgatg
gaggccgcggtccgcgacgccgaggaattccagctggagtcctttcggcgcccgtga

DBGET integrated database retrieval system