KEGG   Gordonia polyisoprenivorans: GPOL_c18530Help
Entry
GPOL_c18530       CDS       T01719                                 

Definition
putative pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GPOL_c18530
Enzymes [BR:gpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     GPOL_c18530
    3.5.1.-  
     GPOL_c18530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2107678..2108292)
Genome map
AA seq 204 aa AA seqDB search
MSSPQSGEWSGPADALVIVDVQNDFCEGGALGVRGGNAVAGAINSILGDYRTVVATRDYH
IDPGAHFSDDPDYVDSWPPHCRVGTDGVAFSPALDTSTVADVFSKGEYSAAYSGFEGADD
DGVSLEQWLSRAGVNSVDVVGIATDHCVRATALDAARAGLRTRVLLNFTAAVDTSTAKAA
LDEMRSAGITLDGDLLYSGASEES
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcccgcagtccggcgaatggtccggcccggccgacgccctggtcatcgtcgac
gtccagaacgacttctgcgagggcggtgcgctgggcgtccgcgggggtaacgccgtggcg
ggtgcgatcaacagcatcctgggcgactaccggaccgtggtggccacacgcgactatcac
atcgatccgggtgcgcacttctccgacgaccccgactacgtcgactcgtggccgccgcac
tgtcgggtcggcaccgatggtgtggcgttctcgcccgcgctggacacctcgacggtcgcc
gatgtcttctccaaaggcgagtacagcgccgcctattcgggattcgagggcgccgacgac
gacggggtatccctcgaacagtggctgagccgggccggggtgaactcggtggacgtcgtc
gggatcgccaccgaccactgcgtgcgtgccactgccctcgacgccgcgcgcgccggtctg
cgtacccgcgtgctgctcaacttcaccgccgccgtcgacacatcgacggccaaggccgcg
ctcgacgagatgcgttcggcgggaataactctcgacggcgatctgctgtacagtggcgca
tccgaggagtcctga

DBGET integrated database retrieval system