KEGG   Gordonia polyisoprenivorans: GPOL_c19770Help
Entry
GPOL_c19770       CDS       T01719                                 

Gene name
mutM2
Definition
formamidopyrimidine-DNA glycosylase MutM (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    GPOL_c19770 (mutM2)
Enzymes [BR:gpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     GPOL_c19770 (mutM2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     GPOL_c19770 (mutM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2246293..2247204
Genome map
AA seq 303 aa AA seqDB search
MPELPEVETVRLGLADHVVGQRITTVEVLHPRAVRRHAGESADLASRLAGKTVTAARRRG
KYLWLDVADDTDDAALVVHLGMSGQMLIARAGAPDHTHLRIRAQLADGNELRFVDQRTFG
GWHVDEHVPDPFTPENASAAMDSDDGVLPRVPASIAHIAPDPFDPGFDTSAVVARIRARH
TEIKRALLDQTIISGVGNIYADEALWLARLHGTRVTDTLAPKKIRELIDAATDVMAQALK
VGGTSFDALYVNVNGQSGYFERSLNAYGREGQPCRRCGRIMRREHFMNRSSFSCPQCQRR
PRM
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaggtcgagaccgtgcgcctgggcttggccgatcacgttgtcggg
caacggatcaccacggtcgaggtactccacccccgcgcggtacgccgccacgcgggcgaa
tccgccgatctcgcgtcgcggctcgcggggaagaccgtcaccgctgcgcgccgtcgtggc
aaatacctctggctcgacgtcgccgacgacaccgacgacgccgcgctggtcgtccacctc
gggatgagcggccagatgctcatcgcacgggcgggagcacccgaccacacccacctgcgt
atccgcgcacaactcgccgacggcaacgagctgcgcttcgtcgatcagcgtaccttcggt
ggctggcacgtcgacgagcatgtgcccgacccgttcacgcccgagaatgcgtctgctgca
atggattcggacgacggtgtgttgccccgcgtgcccgcgtcgatcgcacacatcgcgccg
gacccgttcgatccgggcttcgacacctcggccgtcgtcgcgaggatccgtgcgcgacac
accgagatcaagagagcactgctcgatcagacgatcatctccggggtcggcaacatctac
gccgacgaggccctctggctcgcccggctgcacggcaccagggtcaccgacacgttggcg
cccaagaagattcgcgaactgatcgacgccgccaccgacgtcatggcacaagcgctgaag
gtcggcggtacatcgttcgacgcgctctacgtcaacgtcaacggacagtccggctacttc
gagcggtcgctcaacgcctatggtcgcgagggtcagccgtgccggcggtgcggacggatc
atgcgtcgtgagcacttcatgaaccgcagttcgttctcctgtccgcagtgtcagcgccga
ccacggatgtga

DBGET integrated database retrieval system