KEGG   Gordonia polyisoprenivorans: GPOL_c20170Help
Entry
GPOL_c20170       CDS       T01719                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase Dxr
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00900  Terpenoid backbone biosynthesis
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01130  Biosynthesis of antibiotics
Module
gpo_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GPOL_c20170 (dxr)
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     GPOL_c20170 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Calici_MSP Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFA73056
UniProt: H6MY24
Position
2287149..2288321
Genome map
AA seq 390 aa AA seqDB search
MVVVTTRVLILGSTGSIGVQALEVISEHPELFSVVGVGAGGGNPDLLGRQAREFGVPAHR
VAVADAAVAEKLVAELGDGVLGGPDAMCRLIESVEADVVLNAVVGSIGLRPSLAALRSGA
RLALANKESLVAGGALVLAAAAPGQIVPVDSEHSAIAQCLRGGSADEVDRLVLTASGGPF
RGFTADQLENVTPEQAGRHPTWSMGPMITLNSATLVNKALEVIEAHLLFDVPYDRIDVTV
HPQSIVHSMVTFADGATIAKASPPSMKLPIALALGWPHRVPGSSTACDFSSASSWTFEPV
DNVVFPAIDLARRAGTAGGSLTAVYNAANEAAAEGFFDGRIAFPRIVEIIGRVLDDADQW
RKTPGTVEEIFDADAWARARAAELVATMQR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcgtgacgacacgtgtgctgattctcggttcgaccggttcgatcggggtgcag
gccctcgaggtgatctccgagcatccggagttgttctcggtggtcggcgtcggtgccggg
ggcggcaacccggacttgttgggccggcaggcccgcgagttcggtgtgcctgcgcaccgg
gtggccgtcgcggatgcggcggtggccgagaaactcgtggccgagttgggcgatggggtc
ctgggcggtccggacgcgatgtgtcggctgatcgagtcggtcgaggccgacgtggtgctg
aatgccgtcgtcggttcgatcggtttgcggccgagtctggcggcgttgcggtcgggtgcg
cgactggccttggcgaacaaggagtcgttggtggccgggggagcgctggtgctggcggct
gcggcaccggggcagatcgtgccggtcgattcggagcattcggcgatcgcgcagtgtttg
cgtggcggtagcgccgacgaggtcgaccggctcgtgctgacggcgtcgggcggtccgttc
cgggggttcaccgccgatcagctcgagaatgtgacgcccgaacaggcgggacgtcatccg
acgtggtcgatgggcccgatgatcacgctgaattcggcgaccctggtgaacaaggcgctc
gaggtgatcgaggcgcatctgctcttcgacgtgccctacgaccgcatcgatgtcacggtg
cacccgcagtcgatcgtgcactcgatggtcaccttcgccgacggtgcgacgatcgccaag
gcgtcaccgccgtcgatgaagctgccgatcgcactggcgttgggctggccgcatcgggtg
cccggatcgtcgacggcatgtgatttctcgtcggcgtcgtcgtggacgttcgagccggtc
gacaacgtggtgttcccggcgatcgacctggcccgccgggcggggaccgcaggcggcagc
ctgaccgcggtgtacaacgccgcgaacgaggctgccgcggagggattcttcgacggccgc
atcgcctttccgcggatcgtggagatcatcggtcgtgtgctcgacgatgcagatcagtgg
cgtaaaaccccgggtactgtggaggagatcttcgacgctgatgcgtgggcacgggcccgc
gccgcagagttggtggccacgatgcagcggtga

DBGET integrated database retrieval system