KEGG   Gordonia polyisoprenivorans: GPOL_c20820Help
Entry
GPOL_c20820       CDS       T01719                                 

Definition
putative alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GPOL_c20820
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GPOL_c20820
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GPOL_c20820
Enzymes [BR:gpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     GPOL_c20820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2363785..2365551)
Genome map
AA seq 588 aa AA seqDB search
MTQTPANPTAANPTLANPTAANPTLANPSVANPSGPLGRRRLLQTGAALCVASPLAGPWA
THAVAAPVTTPAASAVFAHGVASGDPLPDRVILWTRITATADAVPGSGRGAGGTVRWEIA
HDERFATVAASGSVNALAERDFTVKVDAAGLTPATEYHYRFRVTSGPATGAVSPVGRTRT
APPSDADVSRVRFGVVSCANWEAGYFGAYRHLRSHRDLHAIVALGDYLYEYGTGEYTGKT
GAVRTHSPRHEIVTLADYRIRHAQYKTDPDLAELHRVLPWICTWDDHESANDTWAEGAEN
HSPDEGAWATRKAAAERAYHEWMPVRAAADDSGTHLYRRLRFGRLLDLSMLDLRTYRDRQ
VSMSSNRIDDPARSITGAAQMRWLTDGLASSAARWKIVGNPVMIAPVLLPPLDTRTTAAL
TESLGLPAEGLPYNPDQWDGYTADRRRLLDAIRSNKVTNVVFITGDIHSSWACDIPVDAA
DYPGSGSVATELVVTSVTSSNIDDILGVPEHTAGAAVSPALMAANRHVRWNDFDAHGYAV
LTVTPSAAQMDWWFVTDKTDARTGRYHGRSYRVTAGSPRVQPAASPLD
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagacccccgcgaacccgactgccgccaacccgactctcgcgaacccgactgcc
gccaacccgactctcgcgaacccttctgtcgcgaacccctctgggccgctcgggcgtcga
cgactcctgcagaccggtgccgcgctgtgcgtggcgagccccctcgcgggcccgtgggca
acgcacgcggtcgccgccccggtgaccacgccggcggcgtcggccgtcttcgcccacggc
gtcgcctcgggtgatccgctgccggaccgggtcatcctctggacccggatcactgcgacc
gccgacgcggtgccgggctcgggacgtggcgcgggaggcaccgtgcggtgggagatcgcc
cacgacgagcggttcgcgaccgtcgccgcgtcgggatcggtgaacgccctcgccgagcgc
gacttcaccgtcaaggtcgatgcagcaggcctcacgccggccaccgagtaccactaccgg
tttcgggtgacctccggtccggccaccggggcggtgtcgccggtgggccgcacccgcacc
gcaccgccatccgacgccgatgtgtcgcgggtgcgcttcggggtggtctcgtgcgcgaat
tgggaggccgggtacttcggcgcgtaccggcatctgcgctcccaccgagacctgcacgcc
atcgtcgcgctcggtgactatctctacgagtacggcaccggtgagtacaccggcaaaacc
ggtgcggtgcgcacacattcaccgcggcacgagatcgtcaccctcgccgattaccgaatc
cgccacgcgcagtacaagaccgacccggacctcgcggagctccatcgtgttctgccctgg
atctgcacctgggacgatcacgaatccgccaacgacacgtgggccgagggcgccgagaac
cactcgcccgacgagggcgcgtgggcgacgcgtaaggccgccgccgaacgcgcgtaccac
gagtggatgccggtacgcgcggccgccgacgactcgggcacccacctctatcgccggttg
cgcttcggccggttgctcgacctgtcgatgctcgacctgcgcacctaccgcgaccggcag
gtgtcgatgtcgtcgaatcgcatcgacgacccggcccggtccatcaccggagccgcccag
atgcgttggctcaccgacggtctcgcgtcctcggcggcgcgatggaagatcgtgggcaat
cccgtgatgatcgcaccggtgttgctgcctccgctcgacacacgcaccaccgccgccctc
accgaatccctcgggctgcccgccgagggattgccctacaatcccgatcagtgggacggc
tacaccgccgatcgtcggcgcctgctcgacgcgatccggtcgaacaaggtgaccaacgtg
gtcttcatcaccggcgacatccactcgtcatgggcgtgtgacatcccggtcgatgccgcc
gactatccgggaagcggttcggtggcaaccgaactcgtcgtcacctcggtcacctccagc
aacatcgacgacatcctcggcgtacccgagcacaccgcgggtgccgcggtctcgccggca
ctgatggcggccaaccggcacgtccggtggaacgacttcgacgcccacggatatgccgtg
ctgaccgtgacgccgtctgcggcacagatggactggtggttcgtcaccgacaagaccgat
gcgcggaccggtcggtatcacggccgctcgtaccgggtgaccgccggatcaccacgcgtg
caaccggccgcgtcgcccctggactga

DBGET integrated database retrieval system