KEGG   Gordonia polyisoprenivorans: GPOL_c21590Help
Entry
GPOL_c21590       CDS       T01719                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase HemY (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GPOL_c21590 (hemY)
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GPOL_c21590 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2451951..2453345
Genome map
AA seq 464 aa AA seqDB search
MPARVAIVGGGVSGLVAAYRLRRALGDDATIDLYEQRERLGGVLHTVDVAGQATDVGAEA
FIVRRPEAVALVDELGLADRVVSPTPRRPAIWAGGRLHPMPAPALMGIPATAEVMAGLAD
PADLARIAAEPDRALAWRPGDDVAVGDLVADRFGASVVARSVDPMLGGVYSSLAADIGVR
EAIPALAARLDAGAPNLSAAVGGLLNPVGTGGPVFGTLVGGYRVLVDALTAAARPALCTD
RQVVAVHADGDRWRVGTESGTDTDYDGVVLAVPAWTAARLLAGIGDEFVATLAAVEPASS
VVVSIALAPGTALPDHSGVLVATGEDLRPKAFTLSSQKWAHVGGDGAAVSVRASFGRYGD
PVADPADDPRIDESLRSWALTDLDRICVAAGVSAPSEHVLEVRVQRWDGGLPRYAPGHLD
RMAGVLDALPPRLALAGSSYAGVGVPACIATAGRAAEVILAALG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgcgggtcgcgatcgtcggcgggggagtctccggcctggtcgcggcctaccgg
ttgcgtcgcgcactcggcgacgacgccacgatcgacctctacgaacagcgcgagcggctc
ggcggcgtgctgcacaccgtagacgtcgccgggcaggccaccgacgtcggagccgaagcg
ttcatcgtgcgccggccggaggctgttgcgctggtcgacgagctcggtctggccgatcgg
gtcgtctcgccgacgccccgccgcccggcgatctgggccggcggccggctgcatccgatg
cccgcccccgccctgatgggtatcccggccacggcagaggtgatggcgggcctggccgat
cccgccgacctcgcccgcatcgccgccgaacccgaccgcgccctggcgtggcggcccggc
gacgacgtggcggtcggtgatctggtggccgaccggttcggcgcatcggtcgtcgcgcgc
agcgtcgatcccatgctcggtggcgtgtactcgtcgctggccgccgacatcggtgtgcgc
gaagcgatcccggcgctggccgcgcgactcgacgcgggcgcgccgaacctgtcggcggcc
gtcggtgggctactcaatccggtcggtaccggtggcccggtgttcgggacactcgtcggt
ggctatcgggtgctcgtcgacgcgctcaccgctgccgcgcggccggccttgtgcaccgat
cgacaggtcgtcgccgtccacgccgacggcgatcggtggcgggtgggcaccgagtccgga
accgacaccgactacgacggcgtcgttctcgctgtgcccgcatggacggcggcccgcctg
ctcgccgggatcggcgatgagttcgtcgcgaccctcgcggcggtcgagccggcgtcgtcg
gtggtggtctcgatcgcgttggcgccgggcacggcactgcccgaccactccggcgtgctg
gtggcgaccggagaagacctgcggcccaaggcattcacgctgtcctcccagaagtgggcg
cacgtcggcggtgacggtgcggcggtgtcggtgcgcgcctcgttcggccgttatggcgac
ccggtggccgaccccgccgacgatccccgtatcgacgagtccctgcggtcgtgggcgctg
accgatctggatcggatctgtgtcgccgccggggtgagcgccccctcggagcacgtgctc
gaggtccgcgtccagcgatgggacggcgggctgccccgttacgcacccggacacctggat
cggatggccggggtgctcgacgcactgccgccgcgactggcgctggccggctcctcgtat
gccggggtcggcgtgccggcgtgtatcgcaacggccggtcgggccgccgaggtgatcctc
gccgctctcggctga

DBGET integrated database retrieval system