KEGG   Gordonia polyisoprenivorans: GPOL_c21860Help
Entry
GPOL_c21860       CDS       T01719                                 

Definition
aldose 1-epimerase-like enzyme
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gpo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2471547..2472434)
Genome map
AA seq 295 aa AA seqDB search
MTTSGDDATQQFHGVRRGTVHGLDAHLIETPHAQAAISVFGGQVVSFRPFGSAHDAVWVS
PVLADLPTPIRGGIPVCWPYFAREGQTGDVPSHGYARTARWAITGAVVTETGEVEISLAP
EGLDQLELRLSMTVRVGATLEQGIHTHNPGTAPARLTEALHNYFRVSDVADVRVEGLAGL
TYADKFDGGAIHPQHGEWTLPSYPARSDRLYPGAGGTYRIVDPGFGRVIEIRGRQARTAV
VWNPGADVAAGMADVGPHWREFVCVETANAGPDVVEVPAGATHSMWQTISVTPVS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacatcgggtgacgacgcaacgcagcaattccacggggtccgcaggggcaccgtt
cacgggctcgacgcccacctcatcgagacgccgcacgcgcaggcggcgatctcggtgttc
ggcgggcaggtcgtgtcgttccggcctttcgggtcggctcacgacgcggtgtgggtgtcc
ccggtgttggccgatctgccgacgcccatccgcggcggaatcccggtctgctggccctat
ttcgctcgcgagggccagaccggcgacgttccctcgcacggttacgcgcgcaccgcccga
tgggcgatcacgggagcggtggtcaccgagaccggcgaagtcgagatctcgttggcacca
gagggactcgaccagctcgagttgcgcctgtcgatgaccgtgcgggtcggcgctacgttg
gagcagggtatccacacccacaacccgggcacagcgcctgcgcggctcaccgaagctctg
cacaactactttcgcgtctccgatgtcgctgatgtccgcgtcgaggggttggccgggctg
acctatgccgacaagttcgacggcggcgcgatccatccgcagcacggcgaatggacgttg
ccgagttaccctgcgcgcagcgaccgcctgtacccgggggcgggcggcacctaccggatc
gtcgaccccggcttcggtcgggtcatcgagatccgtggacgccaggcgcgcacggccgtc
gtctggaatcccggcgccgacgttgccgcgggcatggccgacgtcggtccgcactggcgc
gagttcgtgtgtgtcgagacggccaatgccggccccgacgtcgtcgaggttcccgccggg
gccacccactccatgtggcagaccatctccgtcacgcccgtctcataa

DBGET integrated database retrieval system