KEGG   Gordonia polyisoprenivorans: GPOL_c22060Help
Entry
GPOL_c22060       CDS       T01719                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GPOL_c22060 (ruvA)
Enzymes [BR:gpo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GPOL_c22060 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2490149..2490745
Genome map
AA seq 198 aa AA seqDB search
MIASVRGPVVEVALDHVVIDCAGVGYRVLATPDTLSRMRRGDEITLLTSMIVREDSMTLY
GFTEPDARALFALLQTVTGVGPRLAMATLAVLEPDALRRALADSDVKALTSVPGIGKRVA
ERLVVELRDKVDRPVADAAGGAGARPVGVAGQVAEALVGLGFTAAPAEKAVAAVLAEQPD
ADASMALRRSLALLGKSA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtcggtacgcggaccggtggtcgaggtcgccctcgaccacgtcgtcatcgac
tgcgccggggtgggctaccgggtgttggcgacccccgacacactctcgcggatgcgacgc
ggcgacgagattacgctgctgacctcgatgatcgtgcgcgaggactcgatgaccctgtac
gggttcaccgaacccgacgcccgtgcgttgttcgccctgctgcagacggtcaccggtgtc
gggccacgtctggcgatggcgacgctggcggtactcgagcccgatgcgttgcggcgggcg
ctggccgattccgacgtgaaggcgttgacgagcgtgccgggtatcgggaagcgggtcgcc
gagcggctcgtcgtcgaactgcgtgacaaggtcgaccgaccggtcgccgacgccgccggc
ggtgcgggagcgcggccggtcggggtggccggtcaggtcgccgaggcgctcgtcggactc
ggcttcaccgcggcgccggcggagaaggcggtcgccgcggtgctcgccgagcaaccggat
gcggacgcgtcgatggcgctgcgccggtcgctggccctgctcgggaagtccgcatga

DBGET integrated database retrieval system