KEGG   Gordonia polyisoprenivorans: GPOL_c22520Help
Entry
GPOL_c22520       CDS       T01719                                 

Gene name
gmk
Definition
guanylate kinase Gmk (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gpo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2547351..2547941
Genome map
AA seq 196 aa AA seqDB search
MGQPTRTRGRLVVLVGPSAVGKSTVVARVRELVPDLWFSVSATTRDPRPGEVDGRDYHFV
SRADFDRMIADGELLEWADIHGGLQRSGTPLRPVEQALESGVPVLLEVDLVGARNVRRRL
PEAHLVFLAPPSWDELESRLRGRGTETPEAIDARLATARTEMAAQDEFDHVIVNSRVDRA
ADELVSLLVGPESAAS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggccagcccacacgtacgaggggccgactggtggtactggtcggcccctctgctgtg
ggcaagtcgacggtcgtcgccagggttcgggagctggttcccgacctgtggttcagcgtc
tcggcgaccacccgcgatccccgccccggagaggtcgacggccgcgattatcacttcgtg
tcgcgcgccgacttcgaccgcatgatcgccgacggcgagttgctcgagtgggccgacatc
cacggcgggttgcagcgttcggggacgccgctgcgtcccgtggagcaggcgctggagtcc
ggcgtgcccgtgttgctggaagtcgacctggtcggtgcccgcaatgtgcgacgccgactc
cccgaggcgcacctggtcttcctggcgccgccgagctgggacgaactggaatcacgattg
cgtggtcggggtaccgaaacgcccgaggcgatcgacgcccgactggccaccgcgcgcacc
gagatggctgctcaggacgagttcgatcacgtcatcgtcaactcccgagtcgaccgcgcc
gccgacgaattggtatccttgctggtcggacccgaatcagcggcgagctga

DBGET integrated database retrieval system