KEGG   Gordonia polyisoprenivorans: GPOL_c22760Help
Entry
GPOL_c22760       CDS       T01719                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase TpiA (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GPOL_c22760 (tpiA)
   01230 Biosynthesis of amino acids
    GPOL_c22760 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GPOL_c22760 (tpiA)
   00051 Fructose and mannose metabolism
    GPOL_c22760 (tpiA)
   00562 Inositol phosphate metabolism
    GPOL_c22760 (tpiA)
Enzymes [BR:gpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GPOL_c22760 (tpiA)
Exosome [BR:gpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GPOL_c22760 (tpiA)
  Exosomal proteins of bladder cancer cells
   GPOL_c22760 (tpiA)
  Exosomal proteins of melanoma cells
   GPOL_c22760 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2571160..2571951
Genome map
AA seq 263 aa AA seqDB search
MSGSRKPLIAGNWKMNLNHLEAIALVQKIAFALPAKYFEKVDVTVIPPFTDIRSVQTVVD
GDKLLLTYGAQDLSAHDSGAYTGEISGAFLAKLGCTFVVVGHSERRTMHAETDEVVLAKT
KAALKHGLTPIVCIGEGLDIRESGEHVAYNVAQLKGSLAGLSAEDIAKVVIAYEPVWAIG
TGRVASAADAQEVCAAVRTTLAEIADASTAASVRVLYGGSVNAKNVGDIVGQTDVDGALV
GGASLKADEFSTLSAIAAGGPLP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatcccgtaagccgctcatcgcgggcaactggaagatgaacctcaatcacctc
gaggccatcgcgctggtgcagaagatcgcgtttgcgctgcccgccaagtacttcgagaag
gtcgacgtgacggtgatcccgccgttcaccgacatccgctcggtgcagacggtcgtcgac
ggcgacaaattgctgctgacctacggtgcccaggatctgtcggcccacgattcgggtgcc
tataccggcgagatcagcggggcattcctcgccaagctcgggtgcaccttcgtcgtcgtc
gggcattcggagcgccgcaccatgcacgccgagaccgacgaggtggtgcttgccaagacc
aaggcggcgctcaagcacggcctgacgccgatcgtctgcatcggtgagggactcgacatc
cgggagtccggcgagcacgtcgcctacaacgtcgcgcagctgaagggttcgctggcgggc
ctctcggccgaggacatcgcgaaggtcgtcatcgcctacgagcccgtgtgggccatcggt
accggtcgggtggccagtgccgccgacgcgcaggaggtctgcgcggcggtgcgtaccacg
ctcgccgagatcgccgatgcgtcgacagccgcctcggtgcgggtgctctacggcgggtcg
gtgaacgccaagaacgtcggcgacatcgtcggccagaccgatgtcgacggggctctcgtc
ggcggcgcgtccttgaaggccgacgaattctccacgttgtcggcgatcgccgcgggcggc
cccctgccctga

DBGET integrated database retrieval system