KEGG   Gordonia polyisoprenivorans: GPOL_c27040Help
Entry
GPOL_c27040       CDS       T01719                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GPOL_c27040 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GPOL_c27040 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GPOL_c27040 (trpA)
Enzymes [BR:gpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GPOL_c27040 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3068962..3069783)
Genome map
AA seq 273 aa AA seqDB search
MTAPTVRHAGASKLSPVFTRCREQGRAALIGYLPVGYPTVAGSVESFTTMVEAGCDIIEV
GVPYSDPVMDGPTIQEAADLALTNGVRVRDVFTAVRAITDAGGQAVVMSYWNPILAYGVE
RFSTDLAEAGGAGLITPNLIPEEGHAWHEASDAHGLDRIYLVAPSSTPERLAYTIDACRG
FVYAASTMGVTGARTAVSNAAPELCARIREYSDIPIGVGLGVRSGEQAAEIASYADGVIV
GSALVTAAQAGQGQLRDLVRELADGVAHPNPPR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgccgaccgtccgacacgccggagcctccaagctctcaccggtcttcacccgc
tgccgcgagcagggccgcgccgcgctgatcggctatctgcccgtgggctatccgacggtg
gccggctcggtggagtcgttcaccaccatggtcgaggccgggtgcgacatcatcgaggtc
ggggtgccctattcggatccggtgatggacgggccgacgatccaggaagccgccgatctc
gcactgaccaacggggtgcgggtgcgcgacgtgttcactgcggtccgcgcgatcaccgac
gccggtgggcaggccgtcgtgatgagttactggaatcccatcctcgcctacggtgtcgag
cgtttctccaccgatctcgccgaggccgggggagccggactgatcacccccaacctcatc
ccggaggaggggcatgcgtggcacgaggcctccgacgcccacgggttggaccgcatctat
ctggtcgcaccgtcgtcgaccccggaacgtctggcctacaccatcgatgcgtgtcgcggt
ttcgtctacgcggcctccacgatgggagtgaccggtgctcgcacagcggtgtcgaacgcc
gcccctgagctctgtgcccggatccgcgagtactccgacatcccgatcggcgtcggtctc
ggcgtccgcagcggtgagcaggccgcggagatcgcctcctatgccgacggtgtcatcgtg
ggttcggccctggtgaccgcggcgcaggccggtcagggtcagctgcgtgatctggttcgc
gaactcgccgacggcgtcgcccatccgaacccgccgaggtga

DBGET integrated database retrieval system