KEGG   Gordonia polyisoprenivorans: GPOL_c27050Help
Entry
GPOL_c27050       CDS       T01719                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain TrpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00260  Glycine, serine and threonine metabolism
gpo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01130  Biosynthesis of antibiotics
gpo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GPOL_c27050 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GPOL_c27050 (trpB)
Enzymes [BR:gpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GPOL_c27050 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: AFA73726
UniProt: H6MRS0
Position
complement(3069780..3071156)
Genome map
AA seq 458 aa AA seqDB search
MTTDQSSGTDAAPTVLPTASQGVATRTSLEPDAGGHFGVYGGRHVPEALMAVIDEVTTAY
EKMRTDDDYLAELDRLQRDYVGRPSPLYEATRFSDDAGGARVFLKREDLNHTGSHKINNV
LGQLLLARRMGKSRIIAETGAGQHGVATATGCALFGMECIVYMGRVDTERQALNVARMRL
LGATVIAVETGSATLKDAINEALRDWVTNAHNTYYCFGTAAGPHPFPMLVRDLQRIVGLE
ARAQILSHAGRLPDAVVACVGGGSNAIGVFHPFIDDADVRLVGYEAAGDGVETGRHAATF
TGGTPGAFQGAFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLKDIGRAEYRPITDTE
AMNALALLSRREGIIPAIESAHAVAGALQLGHELARTSPRGAQAGTQGAPIIVVSLSGRG
DKDVDTAAEWFHLFDPPPSESETQSESGAAQSDPGESR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccgatcagagcagcggcaccgacgccgccccgaccgtcctgcccacggccagt
cagggagtggcgacccgcacctccctcgagcccgacgccgggggacacttcggtgtctac
ggtgggcggcacgttcccgaggcgttgatggcggtcatcgacgaggtgaccaccgcctac
gagaagatgcgcaccgacgacgactaccttgccgaactcgaccggctgcaacgtgactac
gtcggtcggccctcgccgctgtacgaggcgacgcggttttccgacgatgccggcggcgcg
cgggtcttcctcaagcgggaagacctgaaccacaccggttcccacaagatcaacaacgtg
ctcggtcagttgttgctggcccgccggatgggcaagtcgcgcatcatcgccgagaccggt
gccggtcagcacggggtcgccaccgccaccggctgtgccctgttcgggatggagtgcatt
gtctacatgggtcgcgtcgacaccgaacgccaggcgttgaacgtggcgcggatgcgtctg
ctcggtgcgacggtgatcgcggtggagaccggctcggcgaccctcaaggacgccatcaac
gaggcgctccgcgactgggtcaccaacgcgcacaacacctattactgtttcggtaccgcc
gcggggccgcatccgttcccgatgctggtacgcgatctgcagcgcatcgtcggcctcgag
gcccgggcgcagatcctctcgcacgccgggcggctgcccgatgcggtggtggcctgcgtc
ggcggcggctcgaacgcgatcggtgtgttccacccgttcatcgacgacgccgacgtacgg
ctcgtcggatacgaggccgccggtgacggcgtcgagaccggccggcacgcggcgaccttc
accggtggtacaccgggcgccttccagggtgcgttctcctacctcctgcaggacgaggac
ggccagaccatcgaatcccattccatctcggcgggtttggattaccccggggtcggtccc
gagcatgcctatctcaaggacatcggccgggccgagtaccgaccgatcaccgacaccgag
gcgatgaatgcactggcgttgctgagccggcgggaagggatcatcccggcgatcgagtcg
gcgcatgcggtggccggggcgttgcagctcggccacgagctcgcccgcacctcaccgcgc
ggggcgcaggccggtacccagggcgcaccgatcatcgtcgtcagcctgtccggtcgcggt
gacaaggacgtcgacaccgccgcggaatggttccatctgttcgatccgccaccatcggaa
tccgagacacagtccgaatccggagcggcccaatcagatccgggggagagccgatga

DBGET integrated database retrieval system