KEGG   Gordonia polyisoprenivorans: GPOL_c27050Help
Entry
GPOL_c27050       CDS       T01719                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain TrpB (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GPOL_c27050 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GPOL_c27050 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GPOL_c27050 (trpB)
Enzymes [BR:gpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GPOL_c27050 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3069780..3071156)
Genome map
AA seq 458 aa AA seqDB search
MTTDQSSGTDAAPTVLPTASQGVATRTSLEPDAGGHFGVYGGRHVPEALMAVIDEVTTAY
EKMRTDDDYLAELDRLQRDYVGRPSPLYEATRFSDDAGGARVFLKREDLNHTGSHKINNV
LGQLLLARRMGKSRIIAETGAGQHGVATATGCALFGMECIVYMGRVDTERQALNVARMRL
LGATVIAVETGSATLKDAINEALRDWVTNAHNTYYCFGTAAGPHPFPMLVRDLQRIVGLE
ARAQILSHAGRLPDAVVACVGGGSNAIGVFHPFIDDADVRLVGYEAAGDGVETGRHAATF
TGGTPGAFQGAFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLKDIGRAEYRPITDTE
AMNALALLSRREGIIPAIESAHAVAGALQLGHELARTSPRGAQAGTQGAPIIVVSLSGRG
DKDVDTAAEWFHLFDPPPSESETQSESGAAQSDPGESR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccgatcagagcagcggcaccgacgccgccccgaccgtcctgcccacggccagt
cagggagtggcgacccgcacctccctcgagcccgacgccgggggacacttcggtgtctac
ggtgggcggcacgttcccgaggcgttgatggcggtcatcgacgaggtgaccaccgcctac
gagaagatgcgcaccgacgacgactaccttgccgaactcgaccggctgcaacgtgactac
gtcggtcggccctcgccgctgtacgaggcgacgcggttttccgacgatgccggcggcgcg
cgggtcttcctcaagcgggaagacctgaaccacaccggttcccacaagatcaacaacgtg
ctcggtcagttgttgctggcccgccggatgggcaagtcgcgcatcatcgccgagaccggt
gccggtcagcacggggtcgccaccgccaccggctgtgccctgttcgggatggagtgcatt
gtctacatgggtcgcgtcgacaccgaacgccaggcgttgaacgtggcgcggatgcgtctg
ctcggtgcgacggtgatcgcggtggagaccggctcggcgaccctcaaggacgccatcaac
gaggcgctccgcgactgggtcaccaacgcgcacaacacctattactgtttcggtaccgcc
gcggggccgcatccgttcccgatgctggtacgcgatctgcagcgcatcgtcggcctcgag
gcccgggcgcagatcctctcgcacgccgggcggctgcccgatgcggtggtggcctgcgtc
ggcggcggctcgaacgcgatcggtgtgttccacccgttcatcgacgacgccgacgtacgg
ctcgtcggatacgaggccgccggtgacggcgtcgagaccggccggcacgcggcgaccttc
accggtggtacaccgggcgccttccagggtgcgttctcctacctcctgcaggacgaggac
ggccagaccatcgaatcccattccatctcggcgggtttggattaccccggggtcggtccc
gagcatgcctatctcaaggacatcggccgggccgagtaccgaccgatcaccgacaccgag
gcgatgaatgcactggcgttgctgagccggcgggaagggatcatcccggcgatcgagtcg
gcgcatgcggtggccggggcgttgcagctcggccacgagctcgcccgcacctcaccgcgc
ggggcgcaggccggtacccagggcgcaccgatcatcgtcgtcagcctgtccggtcgcggt
gacaaggacgtcgacaccgccgcggaatggttccatctgttcgatccgccaccatcggaa
tccgagacacagtccgaatccggagcggcccaatcagatccgggggagagccgatga

DBGET integrated database retrieval system