KEGG   Gordonia polyisoprenivorans: GPOL_c27060Help
Entry
GPOL_c27060       CDS       T01719                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01130  Biosynthesis of antibiotics
gpo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GPOL_c27060 (trpC)
Enzymes [BR:gpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GPOL_c27060 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFA73727
UniProt: H6MRS1
Position
complement(3071216..3072034)
Genome map
AA seq 272 aa AA seqDB search
MSTPNVLDSIIEGVKADVAAREAVVDYAAVKAASVQAPDPKDVMAAFQQPGIGVIAECKR
ASPSKGELATIADPAELARAYEDGGARIISVLTEERRFRGSLADLDAVRAAVNIPVLRKD
FIVGPYQIHEARAHGADMILLIVAALEQNVLASLLDRTESLGMTALVEVHTEEEANRALE
AGASVVGVNNRNLKTLEVDRDNFSRIAPGLPTKVIRVAESGVRGTADLLAFAGAGADAVL
VGEGLVTSGDPRTAVAELVTAGTHPSCPKPVR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgccgaacgtcctcgattcgatcatcgagggagtcaaggccgacgtcgccgcg
cgcgaagcggtcgtcgattacgcggccgtcaaggcggcctcggtccaggcgcccgacccc
aaggacgtgatggctgcgttccagcagcccggcatcggggtgatcgccgagtgcaagcgt
gccagcccgtcgaagggtgagctcgccaccatcgccgaccccgccgaactcgcgcgtgcc
tacgaggacggtggtgcacggatcatcagtgtgctcaccgaggagcggcgcttccgcggg
tcgctcgccgatctcgacgccgtccgcgcggccgtgaacatcccggtgctgcgcaaggat
ttcatcgtcgggccgtaccagatccatgaggcgcgcgctcatggtgccgacatgatcttg
ctgatcgtcgccgctctggaacagaacgtgctggcctcgttgctcgaccgcaccgagagt
ctgggcatgaccgctctcgtcgaggtgcacaccgaggaagaggccaatcgcgcgttggag
gcgggagcctcggtggtcggcgtcaacaaccgcaatctcaagaccctcgaggtcgatcgc
gacaacttctcccggatcgctccgggcctgcccaccaaggtgattcgggtcgccgagtcg
ggtgtgcgcggcaccgccgacctgctggcgttcgccggcgccggcgccgatgcggtcctg
gtgggtgaggggctggtcaccagtggcgacccccgtaccgcggtggcggagctggtgacc
gccggcacccacccgtcctgtccgaaacccgttcgctga

DBGET integrated database retrieval system