KEGG   Gordonia polyisoprenivorans: GPOL_c27990Help
Entry
GPOL_c27990       CDS       T01719                                 

Gene name
glkA
Definition
glucokinase GlkA (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GPOL_c27990 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GPOL_c27990 (glkA)
   00052 Galactose metabolism
    GPOL_c27990 (glkA)
   00500 Starch and sucrose metabolism
    GPOL_c27990 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    GPOL_c27990 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GPOL_c27990 (glkA)
   00524 Butirosin and neomycin biosynthesis
    GPOL_c27990 (glkA)
Enzymes [BR:gpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GPOL_c27990 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3178487..3179464)
Genome map
AA seq 325 aa AA seqDB search
MGELTIGIDIGGTSVRAAVVDDSGVMLDTLRAATPPTAQALEHCLDRLVGELTSRWAAKA
VGMAIAGFLTPDREVVRFAPHLPWREARVAEEMTARIGIPVFTEHDANSAAVAERHYGAA
ARGHNVLVLAIGTGIGAGLLIDGEIYRGSFGVAPELGHLTIVPDGRPCSCGKRGCWERYC
SGTALVDTVVELLADGDWGRSQLATDVAADPGSLTGRRVAGAAADGDAVAVAAFAEFAAS
LGQGLAMIADVFDPDLIVIAGGVGTASGLYLDEAREHYARLITGAGHRQLARIRGTQLGE
NAGVLGAAEVARQGISARVPQVADV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagttgacaatcggcatcgacatcggcggcaccagcgtgcgtgccgccgtggtc
gacgactcgggcgtcatgctcgacaccctgcgcgcggcgaccccgccgacggcccaggcc
ctcgaacactgcctcgaccgtctggtcggcgagctgacctcgcgctgggcggccaaggcc
gtcgggatggcgatcgcgggcttcctcacccccgatcgcgaggtggtgcgattcgccccc
catctgccatggcgggaggcccgggtcgccgaggagatgaccgcgcgcatcggtatcccg
gtgttcaccgaacacgacgcgaactcggccgcggtggccgaacgtcactacggggcggcg
gcccgcggacacaatgtgctggtgctggcgatcggcaccggcatcggtgcggggctgctg
atcgacggggagatctatcgcggcagcttcggtgtcgcaccggagctcgggcacctcacc
atcgtcccggacggccgtccatgctcctgcggtaagcgcggatgttgggaaaggtactgc
agcggaacggctttggtcgacacagtggtcgagttgcttgccgacggcgactggggtcgc
agccagctcgcgaccgacgtggccgccgaccccgggtcgttgaccggccgacgggtggcc
ggtgccgccgccgacggcgacgcggtggcggtggccgccttcgccgagttcgccgcctcg
ctcggccaggggctggcgatgatcgccgacgtcttcgaccccgatctcatcgtcatcgcc
ggcggtgtcgggaccgcgtcggggctgtacctcgatgaggcccgcgaacactatgcgcgt
ctgatcaccggggccggccatcggcagctcgcgcgcatccgcggtacgcaactcggtgag
aacgcgggggtgctcggtgccgccgaggtcgcccgccaggggatcagtgcgcgcgtgccg
caggtcgccgatgtctga

DBGET integrated database retrieval system