KEGG   Gordonia polyisoprenivorans: GPOL_c27990Help
Entry
GPOL_c27990       CDS       T01719                                 

Gene name
glkA
Definition
(GenBank) glucokinase GlkA
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00010  Glycolysis / Gluconeogenesis
gpo00052  Galactose metabolism
gpo00500  Starch and sucrose metabolism
gpo00520  Amino sugar and nucleotide sugar metabolism
gpo00521  Streptomycin biosynthesis
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01120  Microbial metabolism in diverse environments
gpo01130  Biosynthesis of antibiotics
gpo01200  Carbon metabolism
Module
gpo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gpo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GPOL_c27990 (glkA)
   00052 Galactose metabolism
    GPOL_c27990 (glkA)
   00500 Starch and sucrose metabolism
    GPOL_c27990 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    GPOL_c27990 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GPOL_c27990 (glkA)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GPOL_c27990 (glkA)
Enzymes [BR:gpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GPOL_c27990 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N TCR
Motif
Other DBs
NCBI-ProteinID: AFA73819
UniProt: H6MSQ1
Position
complement(3178487..3179464)
Genome map
AA seq 325 aa AA seqDB search
MGELTIGIDIGGTSVRAAVVDDSGVMLDTLRAATPPTAQALEHCLDRLVGELTSRWAAKA
VGMAIAGFLTPDREVVRFAPHLPWREARVAEEMTARIGIPVFTEHDANSAAVAERHYGAA
ARGHNVLVLAIGTGIGAGLLIDGEIYRGSFGVAPELGHLTIVPDGRPCSCGKRGCWERYC
SGTALVDTVVELLADGDWGRSQLATDVAADPGSLTGRRVAGAAADGDAVAVAAFAEFAAS
LGQGLAMIADVFDPDLIVIAGGVGTASGLYLDEAREHYARLITGAGHRQLARIRGTQLGE
NAGVLGAAEVARQGISARVPQVADV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagttgacaatcggcatcgacatcggcggcaccagcgtgcgtgccgccgtggtc
gacgactcgggcgtcatgctcgacaccctgcgcgcggcgaccccgccgacggcccaggcc
ctcgaacactgcctcgaccgtctggtcggcgagctgacctcgcgctgggcggccaaggcc
gtcgggatggcgatcgcgggcttcctcacccccgatcgcgaggtggtgcgattcgccccc
catctgccatggcgggaggcccgggtcgccgaggagatgaccgcgcgcatcggtatcccg
gtgttcaccgaacacgacgcgaactcggccgcggtggccgaacgtcactacggggcggcg
gcccgcggacacaatgtgctggtgctggcgatcggcaccggcatcggtgcggggctgctg
atcgacggggagatctatcgcggcagcttcggtgtcgcaccggagctcgggcacctcacc
atcgtcccggacggccgtccatgctcctgcggtaagcgcggatgttgggaaaggtactgc
agcggaacggctttggtcgacacagtggtcgagttgcttgccgacggcgactggggtcgc
agccagctcgcgaccgacgtggccgccgaccccgggtcgttgaccggccgacgggtggcc
ggtgccgccgccgacggcgacgcggtggcggtggccgccttcgccgagttcgccgcctcg
ctcggccaggggctggcgatgatcgccgacgtcttcgaccccgatctcatcgtcatcgcc
ggcggtgtcgggaccgcgtcggggctgtacctcgatgaggcccgcgaacactatgcgcgt
ctgatcaccggggccggccatcggcagctcgcgcgcatccgcggtacgcaactcggtgag
aacgcgggggtgctcggtgccgccgaggtcgcccgccaggggatcagtgcgcgcgtgccg
caggtcgccgatgtctga

DBGET integrated database retrieval system