KEGG   Gordonia polyisoprenivorans: GPOL_c28340Help
Entry
GPOL_c28340       CDS       T01719                                 

Gene name
dltA
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GPOL_c28340 (dltA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GPOL_c28340 (dltA)
  Amino acid metabolism
   00310 Lysine degradation
    GPOL_c28340 (dltA)
Enzymes [BR:gpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GPOL_c28340 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3216407..3218200
Genome map
AA seq 597 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKEEGDTVEADEPLLEVSTDKVDTEIPAPTSGVLTKII
AQEDDVVEIGGELALIGDAGESADDSGDSGSDDSSDSDDSAGGDEPTEAGAAEQDTEAPS
TEAEAPAEKPAAATGDSGASGTDVLMPELGESVTEGTVTNWLKAVGDEVAADEPLLEVST
DKVDTEIPSPVAGTLLEILAQEDDVIEVGGKLAVIGDASAAGSKPEPEPEPEPEPEPEPA
KSEPEPAKSEAAPATSEPEPEPVKVASAAAPADDSTDLQSTPYVTPLVRKLAAENDIDLS
SLKGTGVGGRIRKQDVLAAAEAKKAPEPASSPAPAAAPAPAAAPAASSPEVKPELAALRG
TTQKINRIRQITAKKTRESLQTSAQLTQVFEVDMSKIVSLRKAAKESFKASEGVNLTFLP
FIAKAVVEALKAHPNVNASIDEDKKEITYYDKVHLGIAVDTEQGLLSPVIHNADDLSIAG
LARAIADIAARARTNGLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKR
PVVITGDDGSESIAVRSMSYLPLTYDHRLIDGADAGRFLTTIKKRLEAGSFAAELGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgagagtgtcaccgaggggaccgtcacc
cggtggttgaaggaagagggcgacaccgtcgaggccgacgagcccctgctggaggtgtcg
accgacaaggtcgacaccgagatccccgcccccacctccggcgtcctcaccaagatcatc
gcccaggaagacgacgtcgtggagatcggcggcgaactcgccctgatcggtgatgccggg
gagagcgccgacgattccggggactccggatccgacgactcgtccgattccgacgactcg
gcgggcggcgacgaaccgaccgaagccggtgcggccgaacaggacaccgaggcgccctcg
accgaggcagaggctccggccgagaagcccgccgccgccaccggtgacagcggggcctcc
gggaccgacgtgctgatgcctgaactcggcgagtcggtcaccgagggcacggtgaccaac
tggctcaaggccgtcggcgacgaggtcgccgcggacgaaccactgctcgaggtctccacg
gacaaggtcgacaccgagatcccgtcccccgtcgccggaaccctgctcgagatcctcgcg
caggaggacgacgtcatcgaggtcggtggcaagctcgcggtgatcggcgatgcctcggcc
gccggctccaagcccgagcccgaaccggagccggagccggagccggagcccgagcccgcc
aagtccgagccagaacccgcgaaatccgaggcggcgcccgccacgagtgagccggaaccc
gaaccggtcaaggtcgcctccgccgcagcccccgccgacgattccaccgatctgcagtcc
accccgtacgtgaccccgttggtccgaaagttggctgcggagaacgacatcgacctatcg
agcctcaagggcaccggggtcggcggccgcatccgcaagcaggacgtgctcgccgccgcc
gaggcgaagaaggcccccgagccggcctcgagcccggccccggccgccgcaccggcgccc
gcagccgcaccggccgcgtcgtcgccggaggtcaagcccgaactcgcggcactgcgtggc
accacgcagaagatcaaccgcatccgtcagatcaccgcgaagaagacccgcgagtcgctg
cagaccagtgctcagctgacgcaggtcttcgaggtcgacatgagcaagatcgtgtcactg
cgcaaggctgccaaggagtcgttcaaggcttccgagggagtgaacctgaccttcttgccg
ttcatcgccaaggccgtcgtggaggcactcaaggcgcatccgaacgtcaacgcctccatc
gacgaggacaagaaggagatcacctactacgacaaggtgcatctcggtatcgccgtcgac
accgagcagggcctgctctcgccggtgatccacaacgccgacgacctctcgatcgccgga
ctggcccgggccatcgccgacatcgccgcccgcgcccgcaccaacggcctcaagcccgac
gagttggccggtggcaccttcaccatcaccaacatcgggagccagggcgccctgttcgac
accccgatcctggtgccgccgcaggcggccatgctcggtaccggcgcaatcgtcaagcgc
ccggtggtcatcaccggcgacgacggttcggagtcgatcgcggtgcggtcgatgtcgtac
ctgccgctgacctacgatcaccgcctgatcgacggcgccgacgccggtcgcttcctgacg
acgatcaagaagcgactcgaggccggctcgttcgccgccgaactgggcctctag

DBGET integrated database retrieval system