KEGG   Gordonia polyisoprenivorans: GPOL_c28340Help
Entry
GPOL_c28340       CDS       T01719                                 

Gene name
dltA
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gpo01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gpo00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:gpo00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3216407..3218200
Genome map
AA seq 597 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKEEGDTVEADEPLLEVSTDKVDTEIPAPTSGVLTKII
AQEDDVVEIGGELALIGDAGESADDSGDSGSDDSSDSDDSAGGDEPTEAGAAEQDTEAPS
TEAEAPAEKPAAATGDSGASGTDVLMPELGESVTEGTVTNWLKAVGDEVAADEPLLEVST
DKVDTEIPSPVAGTLLEILAQEDDVIEVGGKLAVIGDASAAGSKPEPEPEPEPEPEPEPA
KSEPEPAKSEAAPATSEPEPEPVKVASAAAPADDSTDLQSTPYVTPLVRKLAAENDIDLS
SLKGTGVGGRIRKQDVLAAAEAKKAPEPASSPAPAAAPAPAAAPAASSPEVKPELAALRG
TTQKINRIRQITAKKTRESLQTSAQLTQVFEVDMSKIVSLRKAAKESFKASEGVNLTFLP
FIAKAVVEALKAHPNVNASIDEDKKEITYYDKVHLGIAVDTEQGLLSPVIHNADDLSIAG
LARAIADIAARARTNGLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKR
PVVITGDDGSESIAVRSMSYLPLTYDHRLIDGADAGRFLTTIKKRLEAGSFAAELGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgagagtgtcaccgaggggaccgtcacc
cggtggttgaaggaagagggcgacaccgtcgaggccgacgagcccctgctggaggtgtcg
accgacaaggtcgacaccgagatccccgcccccacctccggcgtcctcaccaagatcatc
gcccaggaagacgacgtcgtggagatcggcggcgaactcgccctgatcggtgatgccggg
gagagcgccgacgattccggggactccggatccgacgactcgtccgattccgacgactcg
gcgggcggcgacgaaccgaccgaagccggtgcggccgaacaggacaccgaggcgccctcg
accgaggcagaggctccggccgagaagcccgccgccgccaccggtgacagcggggcctcc
gggaccgacgtgctgatgcctgaactcggcgagtcggtcaccgagggcacggtgaccaac
tggctcaaggccgtcggcgacgaggtcgccgcggacgaaccactgctcgaggtctccacg
gacaaggtcgacaccgagatcccgtcccccgtcgccggaaccctgctcgagatcctcgcg
caggaggacgacgtcatcgaggtcggtggcaagctcgcggtgatcggcgatgcctcggcc
gccggctccaagcccgagcccgaaccggagccggagccggagccggagcccgagcccgcc
aagtccgagccagaacccgcgaaatccgaggcggcgcccgccacgagtgagccggaaccc
gaaccggtcaaggtcgcctccgccgcagcccccgccgacgattccaccgatctgcagtcc
accccgtacgtgaccccgttggtccgaaagttggctgcggagaacgacatcgacctatcg
agcctcaagggcaccggggtcggcggccgcatccgcaagcaggacgtgctcgccgccgcc
gaggcgaagaaggcccccgagccggcctcgagcccggccccggccgccgcaccggcgccc
gcagccgcaccggccgcgtcgtcgccggaggtcaagcccgaactcgcggcactgcgtggc
accacgcagaagatcaaccgcatccgtcagatcaccgcgaagaagacccgcgagtcgctg
cagaccagtgctcagctgacgcaggtcttcgaggtcgacatgagcaagatcgtgtcactg
cgcaaggctgccaaggagtcgttcaaggcttccgagggagtgaacctgaccttcttgccg
ttcatcgccaaggccgtcgtggaggcactcaaggcgcatccgaacgtcaacgcctccatc
gacgaggacaagaaggagatcacctactacgacaaggtgcatctcggtatcgccgtcgac
accgagcagggcctgctctcgccggtgatccacaacgccgacgacctctcgatcgccgga
ctggcccgggccatcgccgacatcgccgcccgcgcccgcaccaacggcctcaagcccgac
gagttggccggtggcaccttcaccatcaccaacatcgggagccagggcgccctgttcgac
accccgatcctggtgccgccgcaggcggccatgctcggtaccggcgcaatcgtcaagcgc
ccggtggtcatcaccggcgacgacggttcggagtcgatcgcggtgcggtcgatgtcgtac
ctgccgctgacctacgatcaccgcctgatcgacggcgccgacgccggtcgcttcctgacg
acgatcaagaagcgactcgaggccggctcgttcgccgccgaactgggcctctag

DBGET integrated database retrieval system