KEGG   Gordonia polyisoprenivorans: GPOL_c28340Help
Entry
GPOL_c28340       CDS       T01719                                 

Gene name
dltA
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00020  Citrate cycle (TCA cycle)
gpo00310  Lysine degradation
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01120  Microbial metabolism in diverse environments
gpo01130  Biosynthesis of antibiotics
gpo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GPOL_c28340 (dltA)
  Amino acid metabolism
   00310 Lysine degradation
    GPOL_c28340 (dltA)
Enzymes [BR:gpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GPOL_c28340 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: AFA73854
UniProt: H6MST6
Position
3216407..3218200
Genome map
AA seq 597 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKEEGDTVEADEPLLEVSTDKVDTEIPAPTSGVLTKII
AQEDDVVEIGGELALIGDAGESADDSGDSGSDDSSDSDDSAGGDEPTEAGAAEQDTEAPS
TEAEAPAEKPAAATGDSGASGTDVLMPELGESVTEGTVTNWLKAVGDEVAADEPLLEVST
DKVDTEIPSPVAGTLLEILAQEDDVIEVGGKLAVIGDASAAGSKPEPEPEPEPEPEPEPA
KSEPEPAKSEAAPATSEPEPEPVKVASAAAPADDSTDLQSTPYVTPLVRKLAAENDIDLS
SLKGTGVGGRIRKQDVLAAAEAKKAPEPASSPAPAAAPAPAAAPAASSPEVKPELAALRG
TTQKINRIRQITAKKTRESLQTSAQLTQVFEVDMSKIVSLRKAAKESFKASEGVNLTFLP
FIAKAVVEALKAHPNVNASIDEDKKEITYYDKVHLGIAVDTEQGLLSPVIHNADDLSIAG
LARAIADIAARARTNGLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKR
PVVITGDDGSESIAVRSMSYLPLTYDHRLIDGADAGRFLTTIKKRLEAGSFAAELGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgagagtgtcaccgaggggaccgtcacc
cggtggttgaaggaagagggcgacaccgtcgaggccgacgagcccctgctggaggtgtcg
accgacaaggtcgacaccgagatccccgcccccacctccggcgtcctcaccaagatcatc
gcccaggaagacgacgtcgtggagatcggcggcgaactcgccctgatcggtgatgccggg
gagagcgccgacgattccggggactccggatccgacgactcgtccgattccgacgactcg
gcgggcggcgacgaaccgaccgaagccggtgcggccgaacaggacaccgaggcgccctcg
accgaggcagaggctccggccgagaagcccgccgccgccaccggtgacagcggggcctcc
gggaccgacgtgctgatgcctgaactcggcgagtcggtcaccgagggcacggtgaccaac
tggctcaaggccgtcggcgacgaggtcgccgcggacgaaccactgctcgaggtctccacg
gacaaggtcgacaccgagatcccgtcccccgtcgccggaaccctgctcgagatcctcgcg
caggaggacgacgtcatcgaggtcggtggcaagctcgcggtgatcggcgatgcctcggcc
gccggctccaagcccgagcccgaaccggagccggagccggagccggagcccgagcccgcc
aagtccgagccagaacccgcgaaatccgaggcggcgcccgccacgagtgagccggaaccc
gaaccggtcaaggtcgcctccgccgcagcccccgccgacgattccaccgatctgcagtcc
accccgtacgtgaccccgttggtccgaaagttggctgcggagaacgacatcgacctatcg
agcctcaagggcaccggggtcggcggccgcatccgcaagcaggacgtgctcgccgccgcc
gaggcgaagaaggcccccgagccggcctcgagcccggccccggccgccgcaccggcgccc
gcagccgcaccggccgcgtcgtcgccggaggtcaagcccgaactcgcggcactgcgtggc
accacgcagaagatcaaccgcatccgtcagatcaccgcgaagaagacccgcgagtcgctg
cagaccagtgctcagctgacgcaggtcttcgaggtcgacatgagcaagatcgtgtcactg
cgcaaggctgccaaggagtcgttcaaggcttccgagggagtgaacctgaccttcttgccg
ttcatcgccaaggccgtcgtggaggcactcaaggcgcatccgaacgtcaacgcctccatc
gacgaggacaagaaggagatcacctactacgacaaggtgcatctcggtatcgccgtcgac
accgagcagggcctgctctcgccggtgatccacaacgccgacgacctctcgatcgccgga
ctggcccgggccatcgccgacatcgccgcccgcgcccgcaccaacggcctcaagcccgac
gagttggccggtggcaccttcaccatcaccaacatcgggagccagggcgccctgttcgac
accccgatcctggtgccgccgcaggcggccatgctcggtaccggcgcaatcgtcaagcgc
ccggtggtcatcaccggcgacgacggttcggagtcgatcgcggtgcggtcgatgtcgtac
ctgccgctgacctacgatcaccgcctgatcgacggcgccgacgccggtcgcttcctgacg
acgatcaagaagcgactcgaggccggctcgttcgccgccgaactgggcctctag

DBGET integrated database retrieval system