KEGG   Gordonia polyisoprenivorans: GPOL_c28340Help
Entry
GPOL_c28340       CDS       T01719                                 

Gene name
dltA
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GPOL_c28340 (dltA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GPOL_c28340 (dltA)
  Amino acid metabolism
   00310 Lysine degradation
    GPOL_c28340 (dltA)
Enzymes [BR:gpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GPOL_c28340 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3216407..3218200
Genome map
AA seq 597 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKEEGDTVEADEPLLEVSTDKVDTEIPAPTSGVLTKII
AQEDDVVEIGGELALIGDAGESADDSGDSGSDDSSDSDDSAGGDEPTEAGAAEQDTEAPS
TEAEAPAEKPAAATGDSGASGTDVLMPELGESVTEGTVTNWLKAVGDEVAADEPLLEVST
DKVDTEIPSPVAGTLLEILAQEDDVIEVGGKLAVIGDASAAGSKPEPEPEPEPEPEPEPA
KSEPEPAKSEAAPATSEPEPEPVKVASAAAPADDSTDLQSTPYVTPLVRKLAAENDIDLS
SLKGTGVGGRIRKQDVLAAAEAKKAPEPASSPAPAAAPAPAAAPAASSPEVKPELAALRG
TTQKINRIRQITAKKTRESLQTSAQLTQVFEVDMSKIVSLRKAAKESFKASEGVNLTFLP
FIAKAVVEALKAHPNVNASIDEDKKEITYYDKVHLGIAVDTEQGLLSPVIHNADDLSIAG
LARAIADIAARARTNGLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKR
PVVITGDDGSESIAVRSMSYLPLTYDHRLIDGADAGRFLTTIKKRLEAGSFAAELGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgagagtgtcaccgaggggaccgtcacc
cggtggttgaaggaagagggcgacaccgtcgaggccgacgagcccctgctggaggtgtcg
accgacaaggtcgacaccgagatccccgcccccacctccggcgtcctcaccaagatcatc
gcccaggaagacgacgtcgtggagatcggcggcgaactcgccctgatcggtgatgccggg
gagagcgccgacgattccggggactccggatccgacgactcgtccgattccgacgactcg
gcgggcggcgacgaaccgaccgaagccggtgcggccgaacaggacaccgaggcgccctcg
accgaggcagaggctccggccgagaagcccgccgccgccaccggtgacagcggggcctcc
gggaccgacgtgctgatgcctgaactcggcgagtcggtcaccgagggcacggtgaccaac
tggctcaaggccgtcggcgacgaggtcgccgcggacgaaccactgctcgaggtctccacg
gacaaggtcgacaccgagatcccgtcccccgtcgccggaaccctgctcgagatcctcgcg
caggaggacgacgtcatcgaggtcggtggcaagctcgcggtgatcggcgatgcctcggcc
gccggctccaagcccgagcccgaaccggagccggagccggagccggagcccgagcccgcc
aagtccgagccagaacccgcgaaatccgaggcggcgcccgccacgagtgagccggaaccc
gaaccggtcaaggtcgcctccgccgcagcccccgccgacgattccaccgatctgcagtcc
accccgtacgtgaccccgttggtccgaaagttggctgcggagaacgacatcgacctatcg
agcctcaagggcaccggggtcggcggccgcatccgcaagcaggacgtgctcgccgccgcc
gaggcgaagaaggcccccgagccggcctcgagcccggccccggccgccgcaccggcgccc
gcagccgcaccggccgcgtcgtcgccggaggtcaagcccgaactcgcggcactgcgtggc
accacgcagaagatcaaccgcatccgtcagatcaccgcgaagaagacccgcgagtcgctg
cagaccagtgctcagctgacgcaggtcttcgaggtcgacatgagcaagatcgtgtcactg
cgcaaggctgccaaggagtcgttcaaggcttccgagggagtgaacctgaccttcttgccg
ttcatcgccaaggccgtcgtggaggcactcaaggcgcatccgaacgtcaacgcctccatc
gacgaggacaagaaggagatcacctactacgacaaggtgcatctcggtatcgccgtcgac
accgagcagggcctgctctcgccggtgatccacaacgccgacgacctctcgatcgccgga
ctggcccgggccatcgccgacatcgccgcccgcgcccgcaccaacggcctcaagcccgac
gagttggccggtggcaccttcaccatcaccaacatcgggagccagggcgccctgttcgac
accccgatcctggtgccgccgcaggcggccatgctcggtaccggcgcaatcgtcaagcgc
ccggtggtcatcaccggcgacgacggttcggagtcgatcgcggtgcggtcgatgtcgtac
ctgccgctgacctacgatcaccgcctgatcgacggcgccgacgccggtcgcttcctgacg
acgatcaagaagcgactcgaggccggctcgttcgccgccgaactgggcctctag

DBGET integrated database retrieval system