KEGG   Gordonia polyisoprenivorans: GPOL_c30220Help
Entry
GPOL_c30220       CDS       T01719                                 

Gene name
pfp
Definition
pyrophosphate--fructose 6-phosphate 1-phosphotransferase Pfp (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GPOL_c30220 (pfp)
   01230 Biosynthesis of amino acids
    GPOL_c30220 (pfp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GPOL_c30220 (pfp)
   00030 Pentose phosphate pathway
    GPOL_c30220 (pfp)
   00051 Fructose and mannose metabolism
    GPOL_c30220 (pfp)
   00052 Galactose metabolism
    GPOL_c30220 (pfp)
  Energy metabolism
   00680 Methane metabolism
    GPOL_c30220 (pfp)
Enzymes [BR:gpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GPOL_c30220 (pfp)
Protein phosphatases and associated proteins [BR:gpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GPOL_c30220 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3424680..3425714)
Genome map
AA seq 344 aa AA seqDB search
MAKRFGILTSGGDCPGLNAVIRGAVLKGETVYGHEFVGFRDGWYGLVYGDIMELDRSVVR
GLSNQGGTILGTSRFGPYSEPDGGPDAIKKVLKNLGIDGVIAIGGEGTASAAKRLYTDGI
NIVGVPKTIDNDINATDYTFGFDTAVNIATEAIDRLRTTGNSHKRCMVLEVMGRHAGWIA
LHSGIAGGAHAILIPEQPESMNQICAWVTSVKNRGRAPMVVVAEGFKLPDMGEAHSTKGL
DGFNRPRLGGIAEVLAPMIEERTGIETRATVLGHIQRGGTPTSFDRVLATRMGMATADLV
ADKYWGHMIALRGTEMHRITFDEALANPKTVPLDQYQEIRVIFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccaagagattcgggattctcacatccggcggcgactgccccggactgaacgcggtg
atccgcggtgcagtactcaagggtgagacggtctacggccacgagttcgtcggcttccgc
gacggctggtacggcctcgtctatggcgacatcatggaactcgaccgctcggtggtgcgt
ggcctgtccaaccagggcggcaccatcctcggcacgagccggttcggcccgtactccgaa
cccgacggtggccccgacgccatcaagaaggttctcaagaacctcgggatcgacggtgtc
atcgccatcggcggtgagggcaccgcatcggcggccaaacgtctctacaccgacggcatc
aacatcgtcggcgtccccaagacgatcgacaacgacatcaacgccaccgactacacgttc
ggcttcgacaccgcggtcaacatcgccaccgaggcgatcgaccggctgcggaccacgggc
aactcgcacaaacgctgcatggtgctcgaggtgatgggacgccacgcgggctggatcgcc
ctgcattcggggatcgccggcggcgcgcacgcgatcctgatcccggagcaacccgagagc
atgaatcagatctgcgcgtgggtgaccagcgtcaagaatcgcggccgcgcgccgatggtc
gtcgtcgccgagggcttcaagttgcccgacatgggagaagcccactccaccaaggggctc
gacggtttcaaccgtccgcgcctcggcggtatcgccgaggtgctggcaccgatgatcgag
gagcgcaccggcatcgagacccgcgcgaccgtgctcggacacatccagcgcggcggcacg
cccacctcgttcgaccgggtactggccactcgcatgggtatggccaccgccgacctcgtc
gccgacaagtactggggtcacatgatcgcgctgcgcggcaccgagatgcaccggatcacc
ttcgacgaggcgctggccaaccccaagacggtgccgctggaccagtatcaggagatccgg
gtcatcttcggctga

DBGET integrated database retrieval system