KEGG   Gordonia polyisoprenivorans: GPOL_c30540Help
Entry
GPOL_c30540       CDS       T01719                                 

Definition
glycoside hydrolase
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GPOL_c30540
Enzymes [BR:gpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GPOL_c30540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3459857..3461419
Genome map
AA seq 520 aa AA seqDB search
MPTPHRTPPSPVPGQFTLVLHSHLPWLANHGRWPVGEEWLYQSWAASYLPVFAMLRRLAA
DGFSDMVSLGITPVLAAQLDDPHCTASMYEWLADWRLRAMEAAVDADTDRRALGLREHRS
ATQALGEFERHWRHGGAATIRQVADSGVAEILGGPLAHPFAPLLDARLRRFSLGEGLADA
RLRWGTRPHGIWAPECAFAPGMETEYAAAGVGHFMVDGPTLRGDTALGRPVGAGDVVAFG
RDLTVSYRVWSPKSGYPGHAAYRDFHTYDHATGLKPSRVTGKTVAAQDKKPYDPQRADAV
IDRHVDDFIGHVRRRLISESQRIGRPALVVAAFDTELFGHWWHEGPVWLERVLRRLPEAG
VQVGTLAGAAAHGYVGAPVDLPPSSWGSGKDWRVWEGPQVSHLVQLNAEVSRTALDAIDK
IVDPRAGRNHVADQIVCEALLTVSSDWPFMVSKDTAADYAIGRAHTHAHATREIVDAALR
GRTAAAERLRHNWSRADNLFAGLDARRLLEITDTTTGRCR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccccgcaccggaccccaccgtcccccgtcccgggccagttcaccctggtcctg
cactcgcatctgccgtggttggccaaccacggcagatggcccgtcggcgaggaatggctg
tatcagtcgtgggccgcctcgtatctgccggtgttcgcgatgctgcgacgactggccgcc
gacggtttctccgacatggtctcgctcgggatcaccccggtgctcgccgcacagctcgac
gacccgcactgcacggcgtcgatgtatgagtggttggccgactggcggttacgggcgatg
gaggcggccgtcgacgccgacaccgaccgccgtgccctgggtctgcgtgaacatcgcagc
gcgacacaggcattgggcgaattcgagcgccattggcgccacgggggcgccgcgacgatc
cggcaggtggccgacagcggcgtcgccgagatcctcggtgggcccctggcccatccgttc
gcaccgttgctcgacgcccggttgcggcgattctccctgggcgaaggcctcgccgatgcc
cgcttgcgctggggcacgaggccgcacgggatctgggctcccgaatgcgccttcgccccg
ggaatggaaaccgagtacgccgccgcgggcgtcggccacttcatggtcgacggcccgacg
ctgcgcggggacaccgcgctcgggcggcccgtcggcgccggcgacgtcgtggccttcggc
cgtgacctgaccgtcagttaccgggtgtggtccccgaaatcgggatatcccggtcatgcc
gcctaccgcgacttccacacctacgatcacgcaaccggcctcaagccgtcgcgtgtgacc
gggaaaaccgttgccgcccaggacaagaagccctacgacccgcagcgggccgatgcagtg
atcgaccgtcacgtcgacgacttcatcggccatgtccgccgacgtctgatctccgagtcg
cagcgcatcggacggccggcgctggtggtcgcggccttcgacaccgagttgttcggtcat
tggtggcacgaggggccggtctggctcgagcgcgtgctgcgcaggctgcccgaggcgggc
gtgcaggtgggcaccctcgccggcgccgccgcacatggctatgtcggtgcgcccgtggat
cttccgccctcgtcgtggggatcgggcaaggactggcgggtctgggaggggccgcaggtg
tcgcatctcgtgcagctcaacgccgaggtgagccggaccgcgctcgacgcgatcgacaag
atcgtcgacccgcgggcgggccgcaaccacgtcgccgatcagatcgtctgtgaagcactg
ctgacggtctcgtcggactggccgttcatggtgtccaaggacaccgcagccgactacgcg
atcggccgggcccacacccacgcccacgcgacccgcgagatcgtcgacgccgccctacgt
ggccgcaccgccgcagcggagaggttgcgacacaactggtctcgcgccgacaacctgttc
gccggcctcgacgcgcgccgcctgctcgagatcaccgacaccaccaccgggcggtgccgg
tga

DBGET integrated database retrieval system