KEGG   Gordonia polyisoprenivorans: GPOL_c30550Help
Entry
GPOL_c30550       CDS       T01719                                 

Definition
glycosyl transferase family protein
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GPOL_c30550
Enzymes [BR:gpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     GPOL_c30550
Glycosyltransferases [BR:gpo01003]
 Polysaccharide
  Storage polysaccharide
   GPOL_c30550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3461410..3462735
Genome map
AA seq 441 aa AA seqDB search
MPVMRVLLISWEYPPVVVGGLGRHVHHLATELAGLGHDVVVLTRRPSGTDAVSHPTTDRV
VDGVRVIAVAEDPPEFSFGTDMMAWTLAMGHGFIRAGLTILAGERGSRATSWTPEVVHAH
DWIVAHPAIALAEIFDVPLISTIHATEAGRHSGWVSGRINRQVHSVEWWLATDSDALITC
SESMRDEVTRLFGPSVPDPSGTERPVPGPRLADITVIHNGIDIRAWPFAPRPTPTGPAEL
LFAGRLEYEKGVQDLLAALPRIRRTHPGTTLTIAGTGTQLEWLTEQARRHRVGRAVTFLG
AVDHRGLVELMHRCAAIVLPSRYEPFGIVALEAAATGIPLVTSTAGGLGEAVRDGVTGLS
FEPADVAGLAAAVRATLTDPDSSAQRARRARARLSEDFAWTEVAARTASVYASAKRRVRQ
PSGRPIIAQRPLPERDPAQPE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtgatgcgggtcctgctcatctcgtgggagtacccaccggtcgtcgtcggcggg
ttgggtcgtcacgtgcaccacctggccaccgagttggccggcctcggccacgacgtcgtc
gtcctcacccgccgtccctcgggtaccgatgcggtgtcgcatccgacgaccgatcgcgtc
gtcgacggggtgcgggtgatcgcggtggccgaggatccgccggagttctccttcggtacc
gacatgatggcctggacactggcgatgggccacggtttcatccgagcggggctgacgatc
ctcgccggcgaacgggggtcacgggcgacgagctggaccccggaggtcgtccacgcgcac
gactggatcgtggcgcacccggccatcgcgctcgccgagatcttcgacgtgccactgatc
tccacgatccacgcgaccgaggccggacgccacagcgggtgggtcagcggccggatcaac
cgccaggtccactcggtggaatggtggctggcgaccgactccgacgccctgatcacctgc
tcggaatcgatgcgcgacgaggtcacccgcctgttcggcccgtcggtgcccgacccctcc
ggcaccgagcgccctgttccgggtccccgcctcgccgatatcacggtgatccacaacggc
atcgacatccgcgcgtggccgttcgcgccgcgcccgacgccgacgggtcccgccgagctg
ctgttcgccggccggctcgaatacgagaagggcgtacaggacctcctcgccgcgctccct
cgtatccgtcgtacccacccgggcacgacgctgaccatcgccggcaccggaacacagctg
gagtggctgaccgagcaggcccgccgacatcgggtcgggcgtgcggtgaccttcctcggc
gcggtcgatcatcggggcctggtggagttgatgcatcggtgcgccgcgatcgtgctgccg
agccgctacgagccgttcgggatcgtggcactcgaggccgcggcgaccgggattcccctg
gtgacctccaccgcgggcggcctgggtgaggcggtccgcgacggggtgaccggcctgtcg
ttcgagcccgccgatgttgccggactggccgcggcggtgcgggcgaccctgaccgatccc
gactcgtcggcgcagcgcgcccggcgggcgcgggcacggttgtcggaggatttcgcgtgg
acggaggtcgcggcgcgcaccgcgtcggtctacgcgtcggccaaacgccgggtccgccaa
ccgtcggggcgaccgatcatcgcgcaacgcccactgcccgaacgagacccggcgcagccg
gagtga

DBGET integrated database retrieval system