KEGG   Gordonia polyisoprenivorans: GPOL_c31110Help
Entry
GPOL_c31110       CDS       T01719                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GPOL_c31110 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    GPOL_c31110 (dapE)
Enzymes [BR:gpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GPOL_c31110 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3522755..3523849)
Genome map
AA seq 364 aa AA seqDB search
MNALDLHGDPIDLTAALVDIHSESRDETAIADAVESALREQTTGFEIVRHGNRVLARTDR
GLDSRVILAGHLDTVPVAGNLPSRRTDDTAEGEVLHGCGTVDMKSGDAVFLHLAATLADP
RHDLTLIFYDCEEIAAEYNGLGVIERELPQWLSGDVAILGEPTAGQIEAGCQGTLRVRLT
ATGTRAHSARAWMGDNAIHKLGEVLTTLAGYSPRRVDIDGCEYREGLSAVGIGGGVAGNV
VPDAAHVDVNFRFAPDHSIESALDHVREVFAGPLASGAVTLELTDSAAGALPGLSHPAAA
ALVDAAQGRFRAKYGWTDVSRFSALGIPAVNLGPGDPSLAHRVDERVPVAQIREVTELLR
TYLS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgctctcgacctccatggcgatccgatcgacctgaccgcggcgctggtcgacatc
cacagtgaatcccgggacgaaaccgccatcgccgacgccgtcgaatccgcgctccgggag
cagaccaccggcttcgagatcgtccgtcacggcaaccgggtgctcgcgcgcaccgaccgg
gggctcgacagccgggtcatcctcgccgggcacctcgacacggtgccggtcgcgggaaat
ctgccgagccggcgcaccgacgacaccgccgagggcgaggtcctgcacgggtgcggaacc
gtggacatgaaatccggtgacgcggtgttcctgcatctcgcggcgacgctggccgatccg
cgccacgacctcacgctcatcttctacgactgcgaggagatcgccgccgagtacaacggg
ctgggggtcatcgaacgtgaactgccgcagtggctttccggcgacgtggcgatcctcggg
gaacccacggccgggcagatcgaggcaggatgccaaggcactctgcgggtacgcctgacc
gcaaccgggacgcgggcacattcggcgcgagcgtggatgggcgacaacgcgattcacaag
ctgggggaggtgctcaccaccctcgccgggtactcgccgcgccgcgtcgacatcgacgga
tgcgagtaccgcgaggggctctcggccgtcgggataggcggcggggtggccggcaacgtc
gtacccgacgccgcccacgtcgacgtcaacttccgtttcgcgcccgaccacagcatcgag
agcgcactcgaccacgttcgcgaggtgttcgccgggccgctcgcctccggtgcggtgacg
ctcgaactcactgattccgccgcaggcgcgttgcccggcctgtcgcatccggctgctgcg
gcactcgtcgacgccgcgcaggggcgattccgcgccaagtacggctggaccgacgtgtca
cgattctcggctctgggtattcccgcggtgaacctcggaccgggggacccgagcctggcc
caccgggtcgacgaacgcgtcccggtcgcccagatccgcgaggtcaccgagttgttgcgg
acctacctgagctga

DBGET integrated database retrieval system