KEGG   Gordonia polyisoprenivorans: GPOL_c33010Help
Entry
GPOL_c33010       CDS       T01719                                 

Gene name
agaA
Definition
alpha-galactosidase AgaA (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GPOL_c33010 (agaA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    GPOL_c33010 (agaA)
   00600 Sphingolipid metabolism
    GPOL_c33010 (agaA)
Enzymes [BR:gpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     GPOL_c33010 (agaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3710919..3712196)
Genome map
AA seq 425 aa AA seqDB search
MSHRWPRAAVVIVTLVVLALGCTPEGDDTVRIGGDGPAIGGLPATPPMGWNSWNSFGCTI
TEQIVRAQADALVSSGLAAKGYRYVVVDDCWMAPDRNAGGQLVADPVRFPSGMAALADYV
HARGLKFGIYAGAREKTCAQFGGTYPGSAGSGGHELTDARAFASWGVDFVKYDWCSGDSA
HDDQVASFTAMRDAIRSTGRPMVYSINPNSGIAGSVPGAQFDWGGVATMTRTTNDISPVW
TTRPAGADATPASGYQGIRDIIDAVAPIGARVADGSFVDMDMLVVGVGNALTPAMERTQM
SMWAMMAAPLMAGNDLTAMSTRTRDILANEAIIGIDQDERVRAGAMVGDNPEIWSRALGS
KGLVVSLTNRADHPRTLKVSLSSLGLTGDSSVSGVDAWTGRRYQAEGGELSVPVGVDDTA
VLSIQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaccggtggccgcgtgcagcggtcgtgatcgtgaccctggttgtgctcgcgctc
ggttgcacgcccgagggagacgacaccgtgcgcatcggcggtgacggtccggcgatcggt
ggactgccggccaccccgccgatggggtggaacagttggaacagcttcggctgcaccatc
accgagcagatcgtgcgtgcgcaggccgacgccctggtgtcctcgggcctggcggccaag
ggatatcgctacgtcgtcgtcgacgactgctggatggcgcccgatcgcaacgccggcggg
caactcgtcgccgaccccgtgcgctttccatccgggatggccgcgctcgccgactacgtg
cacgcccgcgggttgaagttcgggatctacgccggtgcacgggagaagacgtgcgcgcag
ttcggcggaacctatccgggttcggccggcagtgggggtcacgagctcaccgacgcgcgc
gcgttcgcctcgtggggcgtcgatttcgtcaaatacgattggtgctccggtgactccgcg
cacgacgaccaggtcgcctcgttcaccgcgatgcgtgacgcaatccgatccaccggacgc
cccatggtgtacagcatcaaccccaacagcggaatcgccggatcggtccccggagcccaa
ttcgattggggcggtgtggcaaccatgacacgtaccaccaacgacatctcgccggtgtgg
accactcggccggccggtgccgatgcgacaccggcatcggggtatcaggggatccgcgac
atcatcgacgccgtggccccgatcggcgcacgggttgccgacggcagcttcgtcgacatg
gacatgctcgtcgtcggtgtcggcaacgcgttgaccccggcgatggagcgcacccagatg
tcgatgtgggcgatgatggccgccccgctgatggccggcaacgacctcaccgcgatgagc
acccgcacccgcgacatcctcgccaatgaggccatcatcggcatcgatcaggacgagcgc
gtgcgcgccggcgccatggtcggcgacaacccggagatctggagccgcgctctgggttcc
aagggcctcgtcgtctcgttgaccaaccgtgccgaccatccccgcacattgaaggtgagc
ttgtcgagcctcgggctgaccggtgattcgtcggtgtcgggggttgacgcatggaccggg
cgccggtatcaggcggagggcggcgagttgtcggtgcccgtgggcgtcgacgacaccgcc
gtgctgtcgatccagtga

DBGET integrated database retrieval system