KEGG   Gordonia polyisoprenivorans: GPOL_c34340Help
Entry
GPOL_c34340       CDS       T01719                                 

Gene name
adh4
Definition
alcohol dehydrogenase Adh (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:gpo01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gpo00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gpo00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:gpo00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:gpo00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:gpo00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3857493..3858518
Genome map
AA seq 341 aa AA seqDB search
MRAVQVVGYHDKLQLNEIPDPEITGPLDVIVRIGGAGVCRTDLHILEGQWEAKSGVALPY
TIGHENAGWVEAIGDAVTNVAVGDKVILHPLITCGLCRACRDGDDVHCENSKFPGIDTDG
GYADYLKTTARSVVRIDDSLEPAAVAALADAGLTAYHAAAKVARMTRPGDTCVVIGAGGL
GHIGIQVLSAISGVTIVVLDRNPDAVALAVEVGAHEGIVADGNHIEKVLALTDGKGAEAV
LDFVGEGGATAEGVAMLRQAGNYFVVGYGENINVPTIDIISTEINFIGNLVGSYNDLTEL
MTLAAQGKVTLHTATYPLTDFQQALDDLDAGKVRGRAILIP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagtacaggtggtcggataccacgacaagttgcagctcaacgagattccggat
ccggagatcaccgggccactcgatgtgatcgtgcgcatcggcggtgccggcgtgtgccgg
accgacctgcacatcctcgagggccagtgggaggccaagagcggtgtggcccttccgtac
acgatcggccacgagaacgccggctgggtcgaggcgatcggcgatgccgtcaccaacgtc
gcggtgggcgacaaggtgatcctgcacccgctgatcacctgcgggctgtgccgggcgtgc
cgcgacggtgacgacgtgcattgcgagaacagcaagttccccggcatcgacaccgacggc
ggctacgccgactatctgaagacgaccgcccgcagcgtggtgcgcatcgacgactcactc
gagcccgccgcggtggccgcactcgccgacgccgggttgaccgcctatcacgcggccgcc
aaggtcgcgcggatgacccgccccggtgacacgtgcgtcgtgatcggcgcaggcggattg
ggccacatcgggattcaggtgctctcggcgatctccggagtcaccatcgtggtgctcgac
cgcaaccccgacgcggtggcactcgccgtcgaggtcggtgcgcacgagggaatcgtcgcc
gacggcaaccacatcgagaaggttctggcactgaccgatggcaagggcgccgaggcggtg
ctcgacttcgtcggcgaaggcggcgcgaccgccgagggcgtcgcgatgctgcggcaggcc
ggcaactatttcgtcgtcgggtacggcgagaacatcaatgtccccaccatcgacatcatc
tcgaccgagatcaacttcatcggcaatctcgtcggttcctacaacgacctcaccgaactg
atgacgctggccgcccagggcaaggtcacgctgcacaccgcgacctatccgctcaccgat
ttccagcaggccctcgacgacctcgatgcaggcaaggtcagggggcgcgccatcctgatc
ccctga

DBGET integrated database retrieval system