KEGG   Gordonia polyisoprenivorans: GPOL_c34340Help
Entry
GPOL_c34340       CDS       T01719                                 

Gene name
adh4
Definition
alcohol dehydrogenase Adh (EC:1.1.1.1)
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GPOL_c34340 (adh4)
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     GPOL_c34340 (adh4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3857493..3858518
Genome map
AA seq 341 aa AA seqDB search
MRAVQVVGYHDKLQLNEIPDPEITGPLDVIVRIGGAGVCRTDLHILEGQWEAKSGVALPY
TIGHENAGWVEAIGDAVTNVAVGDKVILHPLITCGLCRACRDGDDVHCENSKFPGIDTDG
GYADYLKTTARSVVRIDDSLEPAAVAALADAGLTAYHAAAKVARMTRPGDTCVVIGAGGL
GHIGIQVLSAISGVTIVVLDRNPDAVALAVEVGAHEGIVADGNHIEKVLALTDGKGAEAV
LDFVGEGGATAEGVAMLRQAGNYFVVGYGENINVPTIDIISTEINFIGNLVGSYNDLTEL
MTLAAQGKVTLHTATYPLTDFQQALDDLDAGKVRGRAILIP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagtacaggtggtcggataccacgacaagttgcagctcaacgagattccggat
ccggagatcaccgggccactcgatgtgatcgtgcgcatcggcggtgccggcgtgtgccgg
accgacctgcacatcctcgagggccagtgggaggccaagagcggtgtggcccttccgtac
acgatcggccacgagaacgccggctgggtcgaggcgatcggcgatgccgtcaccaacgtc
gcggtgggcgacaaggtgatcctgcacccgctgatcacctgcgggctgtgccgggcgtgc
cgcgacggtgacgacgtgcattgcgagaacagcaagttccccggcatcgacaccgacggc
ggctacgccgactatctgaagacgaccgcccgcagcgtggtgcgcatcgacgactcactc
gagcccgccgcggtggccgcactcgccgacgccgggttgaccgcctatcacgcggccgcc
aaggtcgcgcggatgacccgccccggtgacacgtgcgtcgtgatcggcgcaggcggattg
ggccacatcgggattcaggtgctctcggcgatctccggagtcaccatcgtggtgctcgac
cgcaaccccgacgcggtggcactcgccgtcgaggtcggtgcgcacgagggaatcgtcgcc
gacggcaaccacatcgagaaggttctggcactgaccgatggcaagggcgccgaggcggtg
ctcgacttcgtcggcgaaggcggcgcgaccgccgagggcgtcgcgatgctgcggcaggcc
ggcaactatttcgtcgtcgggtacggcgagaacatcaatgtccccaccatcgacatcatc
tcgaccgagatcaacttcatcggcaatctcgtcggttcctacaacgacctcaccgaactg
atgacgctggccgcccagggcaaggtcacgctgcacaccgcgacctatccgctcaccgat
ttccagcaggccctcgacgacctcgatgcaggcaaggtcagggggcgcgccatcctgatc
ccctga

DBGET integrated database retrieval system