KEGG   Gordonia polyisoprenivorans: GPOL_c38350Help
Entry
GPOL_c38350       CDS       T01719                                 

Definition
hexose kinase (EC:2.7.1.-)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GPOL_c38350
   01230 Biosynthesis of amino acids
    GPOL_c38350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GPOL_c38350
   00030 Pentose phosphate pathway
    GPOL_c38350
   00051 Fructose and mannose metabolism
    GPOL_c38350
   00052 Galactose metabolism
    GPOL_c38350
  Energy metabolism
   00680 Methane metabolism
    GPOL_c38350
Enzymes [BR:gpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GPOL_c38350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4371035..4371994
Genome map
AA seq 319 aa AA seqDB search
MKSPATPHIVTVTMNPALDIHSSVPILQATEKMRCSRPRYDPGGGGINVARAAVRLGVPA
TAVFTCGGPTGARIEALLTAEGIATGPLGITGGSRESLTVREDRTGQEYRFVLPGPDLTA
TEEQHCLAAMDEYASTATHLVVSGSLPPGCSDGFFPAVSAIADRHGCTLIVDTHGPALLR
VRGAAVIKPSLRELREALDLPLPETDSQIDAARALIARGITDAVVVSRGAAGALVVTTDQ
VTDVAGVPVGSGFGSGVGAGDNMVAGITVALARGRPLPDAVRYGAAAGAAATLTPGTEPC
RRHDVERLYRPAPDSGAQK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaccagccacaccacacatcgtgaccgtcacgatgaatcctgcgctcgacatc
cacagctcggtgccgatcctgcaggcgacggagaagatgcgatgctcgcgcccccgatac
gatccgggtggcggcgggatcaacgtcgcccgggcagcggttcggctcggtgtgccggcc
accgcggtcttcacctgcggcggccccaccggagcacgcatcgaggcactgctcaccgcc
gagggcatcgcaacgggccccctcggcatcaccggtggaagccgggaatcgttgaccgtc
cgcgaggaccggaccggccaggagtaccgcttcgtgttgcccggccccgacctcactgcc
accgaggagcaacactgcctcgccgccatggacgagtatgcgagcaccgcaacgcatctc
gtggtgagtggcagtctcccaccgggatgttcggacggcttcttcccggcggtgtcggcc
atcgcggaccggcacgggtgcacactgatcgtcgacacccacggcccggctctgctgcgg
gtgcggggtgccgcagtgatcaaaccgagccttcgcgaactccgtgaagcattggatctg
cctctgccggagaccgactcacagatcgacgccgcacgagccctgatcgcccggggcatc
accgacgccgtcgtcgtctcccgcggggcggcgggcgcactggtggtgaccaccgatcag
gtgaccgacgtcgccggagtcccggtcgggtccgggttcggcagtggtgtcggggcgggc
gacaacatggtcgccgggatcaccgtcgccctggcccgcggccggccactacccgacgcc
gtccgatacggtgccgccgccggtgccgcggcgacactcaccccgggaaccgaaccgtgc
cgtcgacacgacgtcgaacgtctctaccgacccgcacccgactccggagcgcagaaatga

DBGET integrated database retrieval system