KEGG   Gordonia polyisoprenivorans: GPOL_c38480Help
Entry
GPOL_c38480       CDS       T01719                                 

Gene name
mutM3
Definition
formamidopyrimidine-DNA glycosylase MutM (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gpo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4387375..4388274)
Genome map
AA seq 299 aa AA seqDB search
MPELPEVAAIADFVDGRAAGLPIRRVDIASLSVLKTADPPYTALTGRIVDSVGRVGKYLI
IRTIPGSETDPEPVINLVIHLSRAGWLRWSEDLSPKPLRPGGKSPIALRVHCGIPSATGG
EGFDVTEAGTQKRLAVWIVRDITEVERIATLGPDVLALDRDEFADILAGTGARIKNVLTD
QRVLAGIGNAYSDEILHTAKLSPFATAKTLTGEQIDTLYEAMRDVLTDAIGRLEGQGVAK
LKSEKRTGLKVHARTGLPCPVCGDTIREVAFSDRSFQYCPTCQTGGKVLADRRMSRLLK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgcccgaggttgccgcgatcgccgatttcgtggacggacgggccgccgga
ctcccgatccggcgggtggacatcgcatcgttgtcggtgctcaagaccgccgaccccccg
tacacggccctgaccgggcggatcgtggactccgtcggcagagttggcaaatacctgatc
atccgcaccatccccggttccgagaccgatcccgaaccggtcatcaatctggtcatccac
ctgtcccgggcgggctggctgcgatggagcgaggacctctcacccaaaccccttcgaccc
ggcggcaagagcccgatcgcgctgcgggtgcactgcgggattcccagcgccaccggcggc
gagggtttcgacgtgacggaggccggaacgcagaagcggttggcggtgtggatcgtccgc
gacatcaccgaggtcgagcgcatcgcgacattgggccccgacgtcctcgcgctcgatcgc
gacgagttcgccgacatcctcgccggcaccggcgcgcgcatcaagaacgtgctcaccgat
cagcgggtgctcgccgggatcggcaacgcctactccgacgagatcctgcacaccgcgaag
ctctcgccgttcgccaccgcgaaaaccctgaccggcgaacagatcgacaccctctacgag
gcgatgcgcgacgtgctgaccgacgcgatcgggcgtctcgagggccagggcgtggcaaag
ctgaagtcggagaagcggaccggactcaaggtgcacgcccgtaccggtctgccgtgcccg
gtgtgcggggacacgatccgtgaggtcgccttcagcgaccgatccttccagtactgcccg
acctgccagacgggtggcaaggtcctcgccgaccgccggatgtcgcgactcctcaagtga

DBGET integrated database retrieval system