KEGG   Gordonia polyisoprenivorans: GPOL_c38690Help
Entry
GPOL_c38690       CDS       T01719                                 

Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    GPOL_c38690
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     GPOL_c38690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4410502..4412097)
Genome map
AA seq 531 aa AA seqDB search
MRTFSRRQVLAGAAGAGVTGVIASTAGVGRGFATPGRAVPTTREEHRVVVIGSGFGGGVT
ALRLTRAGVPVVLLERGRRWPTGPNSTTFPSATHPDKRILWHQSTPQVFGRPLSVEPYVG
LFESIAGQNMTPMVAAGWGGGSLVYQGMTLQPSEEVFGAHFPAGLDWPSMNGTYYPRVAR
MLGAAVAPDALIRSPNYRVVREFAAHVRRAGLPLEKIPMPIDWNYALAELAGKMRPSYTN
GDGAIGVNNGGKHSVDVTYLAQAEQTGLLDARILHDVTEIHREPTGRWRVTANRTDETGR
VLETVILSTPTLFLAAGSMNTSRMLVRAGATGAITDLPDAVGTGWGTNADRIYIWNAPTA
DFGAAQGGPVVYGSLNWSDPQHAFTVIQASIPPIPVNTHSTMMVAYGVSAGRGHFTYDAA
TDQAVLQWPHEGDSILQNRYITPAVNRIAGPDSTLIDTNAVLPSTWHPLGGASMGTVCDL
EGRVHGQRGLYVVDGALMPGTCAACNPSMTIAAVAERALDRIVATDVGSLI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacattctctcgccgtcaggtgctcgccggtgccgccggcgccggggtcaccggg
gtgatcgcctccaccgccggggtcggccgcggcttcgcgacgccgggccgagccgttccg
accacacgcgaggaacaccgcgtcgtggtgatcggctccggattcggtgggggagtcacg
gccttacggctgacccgtgccggggtgccggtggtgctcctcgaacgcggacgacgctgg
ccgaccggaccgaattcgacgaccttcccgagtgccacccatcccgacaagcgcatcctc
tggcaccagtcgacaccacaggtcttcggtcgtccgctgtcggtggaaccctatgtgggc
ctgttcgaatcgattgccggacagaacatgacacccatggtcgccgccggctggggtggg
ggctcactggtctatcagggcatgaccctgcaaccgtcggaagaagtgttcggcgcgcat
ttccccgccggtctcgactggccgtcgatgaacggcacctactatccgcgggtcgcccgc
atgctcggtgccgcggtggccccggacgcgttgatccgcagtcccaactaccgcgtcgtc
cgcgagttcgcggcgcacgtacgacgtgccggactgccgttagagaagatcccgatgccg
atcgactggaactatgccctggccgaactcgccgggaagatgcgcccgtcctacaccaac
ggcgacggcgcgatcggcgtcaacaacggcggcaaacacagcgtcgacgtcacctacctg
gcgcaggcggaacagaccggacttctcgatgcccgaatcctgcacgacgtcaccgagatt
caccgcgaaccgaccggccgctggcgcgtgacggcgaaccggaccgatgagaccggccgg
gtcctcgagaccgtgatcctgtccaccccgacgttgttcctcgccgccggctcgatgaac
accagccgaatgctggtgcgcgccggggcaaccggagcgatcaccgatctcccggacgcc
gtcggcaccggctggggcaccaacgccgaccggatctacatctggaatgcccccaccgcc
gatttcggtgcggcgcaagggggcccggttgtgtacggcagcctcaactggtccgacccg
cagcacgcgttcaccgtcatccaggcgtccatcccgccgatcccggtcaacacccactcc
acgatgatggtcgcctacggcgtcagcgccgggcgcggacacttcacctacgacgccgcc
accgaccaagcggtcctgcaatggccgcacgaaggggactcgatactccaaaaccgttac
atcaccccggcggtgaaccgcatcgccggaccggactccaccctgatcgacaccaacgcg
gtgctcccgtcgacctggcatccgctcggcggcgcgtccatgggcaccgtgtgcgacctg
gaaggtcgggtgcacggccaacgcgggctctacgtcgtcgacggtgcactgatgcccggc
acctgcgccgcctgcaacccgtcgatgaccatcgccgcggtcgccgaacgcgcgctggac
cgcatcgtcgccaccgacgtcggctcactcatctga

DBGET integrated database retrieval system