KEGG   Gordonia polyisoprenivorans: GPOL_c40940Help
Entry
GPOL_c40940       CDS       T01719                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00071  Fatty acid degradation
gpo00280  Valine, leucine and isoleucine degradation
gpo00281  Geraniol degradation
gpo00310  Lysine degradation
gpo00360  Phenylalanine metabolism
gpo00362  Benzoate degradation
gpo00380  Tryptophan metabolism
gpo00410  beta-Alanine metabolism
gpo00627  Aminobenzoate degradation
gpo00640  Propanoate metabolism
gpo00650  Butanoate metabolism
gpo00903  Limonene and pinene degradation
gpo00930  Caprolactam degradation
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01120  Microbial metabolism in diverse environments
gpo01130  Biosynthesis of antibiotics
gpo01212  Fatty acid metabolism
Module
gpo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GPOL_c40940
   00650 Butanoate metabolism
    GPOL_c40940
  Lipid metabolism
   00071 Fatty acid degradation
    GPOL_c40940
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GPOL_c40940
   00310 Lysine degradation
    GPOL_c40940
   00360 Phenylalanine metabolism
    GPOL_c40940
   00380 Tryptophan metabolism
    GPOL_c40940
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GPOL_c40940
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GPOL_c40940
   00281 Geraniol degradation
    GPOL_c40940
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GPOL_c40940
   00627 Aminobenzoate degradation
    GPOL_c40940
   00930 Caprolactam degradation
    GPOL_c40940
Enzymes [BR:gpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GPOL_c40940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFA75101
UniProt: H6MSY0
Position
4666456..4667367
Genome map
AA seq 303 aa AA seqDB search
MSDAVIPPPLGPDDLGPDTSPVAYEVGGPADAVAYVTLNRPEYRNAQNSVMTYSLDGAFR
KAVDDASVKVIVLRANGKHFSAGHDIGTPERDFDTYYENAAVLHWDHTDKSGADQRLARE
MEVYMGMCRRWRDIPKPMIAAVHGACIAGGLMLAWVCDFIVASDDAFFSDPVARMGIPGV
EYFAHAYVLGPRRAKEILFTGERFTATQAAEWGMVNHVVERDGLAGKVNGIAEKIVEMPM
QGLFLSKKAVNICEDQMGMRNAMDSVFGWHHFAHSANAESSGGDSLGGMDAKSMKSAAAG
SGS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgccgtcatcccaccacccctgggccccgacgatctcggacccgacacctcg
ccggtcgcctacgaggtcggcggtccggcagacgcggtcgcctacgtgaccctcaaccga
cccgagtaccgcaatgcgcagaactcggtgatgacctattcgctcgacggtgcgttccgt
aaggccgtcgacgacgcgtcggtgaaggtgatcgtgttgcgggccaacggtaagcacttc
tcggccggccacgacatcggtactccggaacgcgatttcgacacctattacgagaatgct
gctgtcctgcattgggatcacaccgacaagtcgggtgccgatcagcgactggcccgtgag
atggaggtctacatggggatgtgtcgccggtggcgggacatccccaagccgatgatcgca
gcggtgcacggggcatgtatcgccggcgggctcatgctggcgtgggtctgcgacttcatc
gtcgcctccgacgacgcattcttctccgacccggtcgcccgcatgggcattcccggcgtc
gagtacttcgcccatgcctacgtcctcgggccccgccgggccaaggagatcctgttcacc
ggcgaacgcttcactgcgacccaggccgccgagtggggcatggtcaatcatgtcgtcgaa
cgagatggactcgcgggcaaggtgaacggcatcgcggagaagatcgtcgagatgccgatg
cagggcctgttcctgtcgaagaaggcggtcaacatctgcgaggaccagatgggcatgcgc
aacgcgatggactcggtcttcggttggcaccacttcgcgcattcggccaatgccgaatcc
tccggcggggattcgctgggcgggatggatgcgaagtcgatgaagagcgccgccgccggg
tcggggtcctga

DBGET integrated database retrieval system