KEGG   Gordonia polyisoprenivorans: GPOL_c41180Help
Entry
GPOL_c41180       CDS       T01719                                 

Gene name
hsaG
Definition
acetaldehyde dehydrogenase HsaG (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GPOL_c41180 (hsaG)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GPOL_c41180 (hsaG)
   00650 Butanoate metabolism
    GPOL_c41180 (hsaG)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    GPOL_c41180 (hsaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GPOL_c41180 (hsaG)
   00622 Xylene degradation
    GPOL_c41180 (hsaG)
   00621 Dioxin degradation
    GPOL_c41180 (hsaG)
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GPOL_c41180 (hsaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4689455..4690360)
Genome map
AA seq 301 aa AA seqDB search
MAAKLTAAIIGSGNIGTDLMYKLERSEVIAPRWMVGIDADSEGMKRAADHGLITMSGGAD
ELLSSSEKPDLIFEATSAYVHREYAPRYEQAGITAVDLTPAAVGPAVVPPANLREHLDAP
NTNMITCGGQATIPMVHAVSSVVPVPYAEIVASVASVSAGPGTRANIDEFTRTTSKGIET
IGGAARGKAIIILNPADPPMIMRDTIFCAIPDDADTDAIAESIRKREKEIQAYVPGYRLL
QDPQFDPPSVLNGGHARVSIFVEVEGAGDFLPPYAGNLDIMTAAATKVGEEIAKQKLGVS
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggcagccaagctgaccgcggcgatcatcgggtcgggcaacatcggtaccgacctgatg
tacaagctggaacgatccgaggtgatcgctccccgatggatggtcgggatcgatgccgac
tcggagggcatgaagcgggccgccgaccacgggctcatcacgatgagcggcggcgccgac
gagttgctctcgtcgtcggagaaaccggacctgatcttcgaggcgacgtcggcctatgtg
caccgcgaatacgcgccgcgatacgagcaagcgggtatcaccgcggtcgacctgacgccg
gcggcggtgggcccggcagtggtgccgccggccaatctgcgcgagcacctcgacgcaccg
aacaccaacatgatcacctgcggtgggcaggcgacgatcccgatggtccacgcggtgtcc
tcggtggtgccggtgccctacgccgagatcgtcgcatcggtcgcatcggtgtcggcaggt
ccggggacgcgggccaacatcgacgagttcacccggaccacatcgaaggggatcgagacg
atcggcggtgccgcgcgcggcaaggcgatcatcatcctcaatccggccgatccgccgatg
atcatgcgcgacaccatcttctgcgccatccccgacgacgccgacaccgatgccatcgcc
gagtcgatccgcaagcgggagaaagagatccaggcctacgtgcccggctatcgactactg
caggacccgcagttcgatccgccgagtgtgctcaacggcggccacgcccgcgtctcgatc
ttcgtcgaggtcgagggcgccggggacttcttgccgccgtacgccggcaacctcgacatc
atgaccgccgcagccaccaaggtcggcgaggaaatcgcgaagcagaagttgggggtttcg
gcatga

DBGET integrated database retrieval system