KEGG   Gordonia polyisoprenivorans: GPOL_c42740Help
Entry
GPOL_c42740       CDS       T01719                                 

Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GPOL_c42740
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GPOL_c42740
   00650 Butanoate metabolism
    GPOL_c42740
  Lipid metabolism
   00071 Fatty acid degradation
    GPOL_c42740
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GPOL_c42740
   00310 Lysine degradation
    GPOL_c42740
   00360 Phenylalanine metabolism
    GPOL_c42740
   00380 Tryptophan metabolism
    GPOL_c42740
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GPOL_c42740
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GPOL_c42740
   00281 Geraniol degradation
    GPOL_c42740
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GPOL_c42740
   00627 Aminobenzoate degradation
    GPOL_c42740
   00930 Caprolactam degradation
    GPOL_c42740
Enzymes [BR:gpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GPOL_c42740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4856410..4857231
Genome map
AA seq 273 aa AA seqDB search
MTTMSHAESATDEAPHCLVEQRGHVLIVTMNRPAARNALSSEMMAIMTEAWDRVDSDPEI
RAAILTGAGGAFCAGMDLKAMSRNAPGDTVKQGAWDPASLPALLKGRRLTKPLIAAVEGP
AIAGGTEILQGTDIRVAGRSARFGVSEARWGLFPLGGSAVRLVRQIPYTVACDILLTGRH
ITADEAKEYGLIGHVVDDGAALDKALELADAICANGPLAVQAILRTIRETEGMHELDAFA
IEAPIGISVFQSKDAKVGPKAFAAKEKPVFTGE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatgtcgcatgccgaatccgccaccgacgaggcgccacactgtctggtcgag
caacgcggacacgttctgatcgtcaccatgaaccgccccgccgcccgcaacgcgctgtcc
tcggagatgatggcgatcatgaccgaggcctgggaccgggtcgactccgatcccgagatc
cgggcggcgatcctcaccggcgcggggggcgcgttctgcgccggcatggacctcaaggcc
atgtcgcgcaacgctcccggcgacacggtcaaacagggcgcctgggacccggcgtcgctg
cctgcgctgctcaaaggccgccgactgaccaaaccgctcatcgctgccgtggagggcccg
gcgatcgccggcggtaccgagatcctgcagggcaccgacatccgggtggccggccgaagt
gccagattcggtgtatccgaagcacgttggggactcttcccgctcggcggcagcgcagta
cggctggtgcgacagatcccctacaccgtcgcctgtgacattctcttgacgggccgtcac
atcaccgccgacgaggccaaggaatacggtttgatcggccacgtcgtcgacgacggcgcc
gccctcgacaaggctctcgagctcgccgatgcgatctgcgccaacggtcccctcgccgta
caggcgatcctgcggaccatccgcgagaccgagggaatgcacgaactcgacgccttcgcc
atcgaggcgccgatcggcatctcggtgttccagagcaaggacgccaaggtcggcccgaaa
gcattcgccgccaaggaaaagccggtcttcaccggcgagtga

DBGET integrated database retrieval system