KEGG   Gordonia polyisoprenivorans: GPOL_c43330Help
Entry
GPOL_c43330       CDS       T01719                                 

Gene name
folP2
Definition
dihydropteroate synthase FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GPOL_c43330 (folP2)
Enzymes [BR:gpo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     GPOL_c43330 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4919876..4920763)
Genome map
AA seq 295 aa AA seqDB search
MSPAPTQVMGIINVTADSFSDGGRYLDLDAALAHGQQLLDDGADLIDVGGESTRPGAVRV
DPEIETARVAPVISALTDLGATVSVDTMRASVAAAAIEAGARIVNDVSGGRADADMARVM
ADAGLPWILMHWRPAGDDSDAGRRFTHRVDDVGGYHDVVAEVSRELLGQVDAAVSAGVDP
DRIILDPGLGFAKTADHNWALLHALPTFVGLGFPILVGASRKRFLGTLLAAGGADRPPAG
RDVATAAVSTLAAAGGAWGVRVHDVAASRDAVLVAAAWRAGGCGRVHAHVQAGER
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcccgcgccgacccaggtgatgggcatcatcaacgtcaccgccgactcgttctcc
gacggcggccgctacctggatctcgacgccgcgctcgcgcacgggcaacaactgctcgac
gacggcgccgacctcatcgacgtcggcggtgaatccacccgtcccggcgccgttcgcgtt
gatccggagatcgagacggcgcgggtcgccccggtgatctccgcgctcaccgacctcggg
gcaacggtttccgtcgacaccatgcgcgcctcggtcgccgcggccgcgatcgaggcgggt
gcgcgcatcgtcaacgacgtgtccggaggccgtgccgacgccgatatggcccgtgtgatg
gctgatgccgggctgccgtggatcctcatgcactggcgtccggccggtgacgactccgac
gccgggcgccgcttcactcaccgggtcgacgacgtcggcggctatcacgacgtcgtcgcc
gaggtcagtcgcgaactgctcggccaggtcgatgccgccgtcagcgcgggcgtcgacccg
gatcggatcatcctcgacccgggcctgggtttcgccaagaccgccgaccacaactgggcg
ctgctgcacgcgttgccgacgttcgtcggactgggtttcccgatcctggtcggcgcgtct
cgtaaacgtttcctgggcacgttgttggccgccggcggcgccgaccggccaccggccggt
cgggacgtcgccaccgcagcggtgtcgaccctcgccgctgccggcggggcctggggggtg
cgggtccatgacgtcgccgccagccgcgacgcggtcctcgtggccgcggcctggcgagca
ggtggatgcggtcgggtacacgcccacgtacaggcaggggagcgctga

DBGET integrated database retrieval system