KEGG   Gordonia polyisoprenivorans: GPOL_c43340Help
Entry
GPOL_c43340       CDS       T01719                                 

Gene name
folE
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gpo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4920760..4921374)
Genome map
AA seq 204 aa AA seqDB search
MTTLDQRGPDSAAEPVREFDQARAEAAVRELLLAIGEDPDREGLRRTPTRVANAYREMFA
GLYTDPSEVLATTFDEDHDELVLVKDIPLYSTCEHHLVSFHGVAHVGYIPGVSGQVTGLS
KLARLVDLYAKRPQVQERLTSQVADALVRRLNPRGVIVVIEAEHLCMAMRGIRKPGARTT
TSAVRGLFKTSAVSRGEALDLITR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacactcgaccagcggggtccggattcggctgcggaaccggtgcgggagttcgat
caggcccgggccgaggccgcggtgcgtgaactgctcctcgcgatcggcgaggacccggat
cgagaagggttgcggcgcaccccgacccgtgtcgccaacgcctatcgggagatgttcgcc
gggctctacaccgatccgtcggaggtgctcgcgacgaccttcgacgaggaccacgacgag
ttggtgctggtcaaggacatcccgctgtattcgacgtgcgaacatcacctcgtgtccttt
cacggggtcgcgcacgtcggttacatcccgggcgtcagcgggcaggtgaccggtctgtcc
aagctggcgcgactggtcgatctgtacgcgaaacgtccgcaggttcaggaacgtctcacc
agccaggtcgccgatgcccttgtgcgacggctcaatccgcgcggcgtgatcgtcgtgatc
gaggccgagcacctgtgcatggccatgcgtggcatccgcaagccgggcgcgcggaccacc
acgtcggcggtgcgcggtctgttcaagaccagtgcggtctcgcggggcgaagcgctcgac
ctcatcacccggtga

DBGET integrated database retrieval system