KEGG   Gordonia polyisoprenivorans: GPOL_c43340Help
Entry
GPOL_c43340       CDS       T01719                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00790  Folate biosynthesis
gpo01100  Metabolic pathways
Module
gpo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GPOL_c43340 (folE)
Enzymes [BR:gpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     GPOL_c43340 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI AAA_22
Motif
Other DBs
NCBI-ProteinID: AFA75337
UniProt: H6MVN7
Position
complement(4920760..4921374)
Genome map
AA seq 204 aa AA seqDB search
MTTLDQRGPDSAAEPVREFDQARAEAAVRELLLAIGEDPDREGLRRTPTRVANAYREMFA
GLYTDPSEVLATTFDEDHDELVLVKDIPLYSTCEHHLVSFHGVAHVGYIPGVSGQVTGLS
KLARLVDLYAKRPQVQERLTSQVADALVRRLNPRGVIVVIEAEHLCMAMRGIRKPGARTT
TSAVRGLFKTSAVSRGEALDLITR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacactcgaccagcggggtccggattcggctgcggaaccggtgcgggagttcgat
caggcccgggccgaggccgcggtgcgtgaactgctcctcgcgatcggcgaggacccggat
cgagaagggttgcggcgcaccccgacccgtgtcgccaacgcctatcgggagatgttcgcc
gggctctacaccgatccgtcggaggtgctcgcgacgaccttcgacgaggaccacgacgag
ttggtgctggtcaaggacatcccgctgtattcgacgtgcgaacatcacctcgtgtccttt
cacggggtcgcgcacgtcggttacatcccgggcgtcagcgggcaggtgaccggtctgtcc
aagctggcgcgactggtcgatctgtacgcgaaacgtccgcaggttcaggaacgtctcacc
agccaggtcgccgatgcccttgtgcgacggctcaatccgcgcggcgtgatcgtcgtgatc
gaggccgagcacctgtgcatggccatgcgtggcatccgcaagccgggcgcgcggaccacc
acgtcggcggtgcgcggtctgttcaagaccagtgcggtctcgcggggcgaagcgctcgac
ctcatcacccggtga

DBGET integrated database retrieval system