KEGG   Gordonia polyisoprenivorans: GPOL_c43680Help
Entry
GPOL_c43680       CDS       T01719                                 

Gene name
gbh
Definition
guanidinobutyrase Gbh (EC:3.5.3.7)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GPOL_c43680 (gbh)
Enzymes [BR:gpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GPOL_c43680 (gbh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4959424..4960413
Genome map
AA seq 329 aa AA seqDB search
MSDNVIAGLDTQFPVIDGVVGQVDAARFPRYGAPATFARLPRRDQVADADVHILGIPFDT
GVSYRPGARFGPGHIRASSKLLRPFNPALGVAPFAQQQVVDCGDLSVNPFAITEAIDTIS
AAARTLGADGATPLILGGDHTVALPMLRALHDLHAKPVAVLHFDAHLDTWNSYFGAPYTH
GTPFRRASEEGLIDMERSMHVGIRGPLYSAADLDDDSALGFAVVRADDYEFDGVASIVER
VRTRLAGGPVYVSIDIDVLDPAHAPGTGTPEAGGLTSRELLNTLRGLRGLDIVGTDIVEV
SPAYDHAEITGIAAAHVAYEMLSILGPRR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaacgtgattgccggtctcgacacccagttcccggtcatcgacggggtggtg
gggcaggtcgatgcagcacgcttcccccgctacggcgcaccggccacctttgcccgcctg
ccgcgtcgggaccaggtcgccgatgccgacgtgcacatcctcggcatcccgttcgacacc
ggggtcagctatcggccgggcgcacgattcggccccgggcacattcgcgcatcgtcgaag
ttgttgcggcccttcaatcccgccctcggcgtggcaccgttcgcacagcagcaggtcgtc
gattgcggtgacctgtcggttaatccgttcgccatcaccgaggccatcgacaccatcagc
gccgcggcgagaaccctcggcgccgacggcgccaccccgctgatcctcggcggcgaccac
accgtcgcgctgcccatgctgcgcgcgctgcacgacctacacgcgaaacccgttgcggta
ctacacttcgatgcccacctcgacacctggaactcctacttcggtgcgccctatacccac
ggcacaccgttccgccgggccagcgaggaaggactgatcgacatggaacgctcgatgcac
gtcggcatccgcggaccgctctacagtgccgccgacctcgacgacgactcggcgctcggg
ttcgccgtggtacgcgccgatgactacgaattcgacggtgtggcaagcattgtcgaacgg
gtgcgcacgcgcctggccggtggtccggtgtacgtctccatcgacatcgacgtcctcgat
ccagcgcacgcaccgggcaccggaacccccgaggccggcggcctgacctcccgcgagctg
ttgaacaccctgcgtggcctacgcggcctcgacatcgtcggcaccgacatcgtcgaggtc
tcgcccgcctacgaccacgccgagatcaccggtatcgccgccgcacatgtcgcctacgag
atgctgtcgatcctcgggccccgccgctga

DBGET integrated database retrieval system