KEGG   Gordonia polyisoprenivorans: GPOL_c46110Help
Entry
GPOL_c46110       CDS       T01719                                 

Definition
putative aldolase, class 2
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GPOL_c46110
Enzymes [BR:gpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     GPOL_c46110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5212385..5213050
Genome map
AA seq 221 aa AA seqDB search
MTVDTTVLRERVAAMSRHLGERGLFIGTAGNVSARVDGVVAITASGIDLTSAYADEVTVV
DLDGAVLDGHLSPSSEVDLHLGVYRQPQFAGLSGVVHTHSRFATALSIVCTELPVIHYQQ
LSLGGSLRVAPFETFGTPELATAVHSALSGRLAALMANHGAVALGNDLAAAADNALLLEW
LCEIYWRAHAIGAPRNLNESQQHGVIEHALRIGYGGTKEIG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgacagtcgacaccaccgttctgcgcgaacgcgtcgccgcaatgtcccgccacctcggc
gaacgcgggctcttcatcggtaccgcgggcaacgtcagtgcccgggtcgacggggtggtg
gccatcaccgcatccgggatcgatctcacctccgcatatgccgacgaggtcaccgtcgtc
gacctcgacggcgcggtactcgacggtcatctgtcgccgagttccgaggtggatctgcat
ctcggggtgtaccggcagccgcagttcgcgggcctgtccggggtggtgcacacccactcc
cgattcgcgacggcgctgtccatcgtgtgcaccgagttgccggtgatccactatcaacag
ctctccctcggcggatcgctgcgtgtcgcgccgttcgagaccttcggcacccccgagctc
gccacggcggtgcactcggcgctgagcggacgcctcgcggcactgatggccaatcatggt
gcggtggctctcggcaacgatctcgccgccgccgccgacaacgcgctgctcctcgagtgg
ttgtgtgagatctattggcgcgcacatgccatcggtgcgccccgtaatctgaacgagtcc
cagcagcacggcgtcatcgagcatgcgctgcgcatcggatacggcggcacgaaggagatc
ggatga

DBGET integrated database retrieval system