KEGG   Gordonia polyisoprenivorans: GPOL_c46110Help
Entry
GPOL_c46110       CDS       T01719                                 

Definition
(GenBank) putative aldolase, class 2
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00051  Fructose and mannose metabolism
gpo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GPOL_c46110
Enzymes [BR:gpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     GPOL_c46110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AFA75612
UniProt: H6MYH9
Position
5212385..5213050
Genome map
AA seq 221 aa AA seqDB search
MTVDTTVLRERVAAMSRHLGERGLFIGTAGNVSARVDGVVAITASGIDLTSAYADEVTVV
DLDGAVLDGHLSPSSEVDLHLGVYRQPQFAGLSGVVHTHSRFATALSIVCTELPVIHYQQ
LSLGGSLRVAPFETFGTPELATAVHSALSGRLAALMANHGAVALGNDLAAAADNALLLEW
LCEIYWRAHAIGAPRNLNESQQHGVIEHALRIGYGGTKEIG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgacagtcgacaccaccgttctgcgcgaacgcgtcgccgcaatgtcccgccacctcggc
gaacgcgggctcttcatcggtaccgcgggcaacgtcagtgcccgggtcgacggggtggtg
gccatcaccgcatccgggatcgatctcacctccgcatatgccgacgaggtcaccgtcgtc
gacctcgacggcgcggtactcgacggtcatctgtcgccgagttccgaggtggatctgcat
ctcggggtgtaccggcagccgcagttcgcgggcctgtccggggtggtgcacacccactcc
cgattcgcgacggcgctgtccatcgtgtgcaccgagttgccggtgatccactatcaacag
ctctccctcggcggatcgctgcgtgtcgcgccgttcgagaccttcggcacccccgagctc
gccacggcggtgcactcggcgctgagcggacgcctcgcggcactgatggccaatcatggt
gcggtggctctcggcaacgatctcgccgccgccgccgacaacgcgctgctcctcgagtgg
ttgtgtgagatctattggcgcgcacatgccatcggtgcgccccgtaatctgaacgagtcc
cagcagcacggcgtcatcgagcatgcgctgcgcatcggatacggcggcacgaaggagatc
ggatga

DBGET integrated database retrieval system