KEGG   Gordonia polyisoprenivorans: GPOL_c47020Help
Entry
GPOL_c47020       CDS       T01719                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gpo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5315913..5316524)
Genome map
AA seq 203 aa AA seqDB search
MYEGPIQDLIDELAKQPGLGPKGAQRIAFALLAGEKKEIDRLVAALIQVRDNVTFCAECG
NVSANNLCRICSDARRDATKICVVEEPKDVHAIERTKEFHGRYHVLGGALDPLSGIGPDQ
LRIRELLRRLATTADGTDVTEIIVATDPNTEGEATATYLLRMLKDFPGLSVTRLASGLPM
GGDLEFADELTLGRALSGRRILA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagggccccatccaggatctgatcgacgagctcgccaaacaacccgggctcggc
ccgaagggtgcccagcgcatcgcgttcgcgctgctggccggcgagaaaaaggagatcgac
cggctggtcgcggctctcatccaggtccgcgacaacgtcaccttctgcgccgaatgcggc
aacgtctcggccaacaatctctgtcggatctgctcggatgcccgacgtgacgcgaccaag
atctgcgtcgtcgaggaacccaaggacgttcacgcgatcgagcgcaccaaggagttccac
ggccgctatcacgtcctcggcggcgcactcgacccgctgtcggggatcggccccgaccag
ttgcgcatccgcgagttgctgcgacggctggccaccaccgccgacggcaccgacgtcacc
gagatcatcgtggccaccgaccccaataccgagggcgaggccaccgcgacgtacctgctg
cgcatgctcaaggacttcccggggctgtcggtgacgcgtctggcgtcggggctaccgatg
ggcggcgacctggagttcgccgacgaactcaccctcggccgtgcgctgtcgggccgccgc
atcctggcatga

DBGET integrated database retrieval system