KEGG   Gordonia polyisoprenivorans: GPOL_c48020Help
Entry
GPOL_c48020       CDS       T01719                                 

Definition
pfkB family kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GPOL_c48020
Enzymes [BR:gpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GPOL_c48020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5418437..5419285
Genome map
AA seq 282 aa AA seqDB search
MNSSSRVAVVGTLNLDQVVHVERLPADGETVLGLSQTERPGGKGANQAAAAAAITSTSLI
AAVGDDAAGTTMLEYQRAQGVDVEHVRRVTGLSGRAVIEVDADGTNRIIVLSGANAELTA
DHVTASLDALDPEVVLTQLESPREVTDAAARWCRAHLRRFVLNPSPVAALDDSILALADP
LVVNEIEAAYYGTADDLEPLAQRLRSRCTSAVITLGAEGVLVIDDGRVTRINVRGVTAVD
TTGAGDVFAGTLVAHLAAGIELPEAASLAADTATDFVSRSRN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaactcctcgtcgcgtgtcgccgtggtcggcaccctcaatctcgaccaggtggtgcac
gtcgagcgtctacccgccgacggtgagacggtcctcgggctgtcccagacggagcggccg
ggcggcaagggcgccaatcaggccgcggcagcggcagcgatcacctcgacgtcgctgatc
gccgcggtcggcgacgacgcggcgggcaccacgatgctcgaatatcaacgtgctcagggt
gtcgacgtcgagcacgttcgtcgcgtcaccggcctcagcggacgggcggtcatcgaggtc
gacgccgacggcaccaaccggatcatcgtgctctccggtgcgaatgccgagctgaccgcc
gatcacgtcacggcgtccttggacgcactggaccccgaagtggttctcacacagctggag
tcgccccgcgaggtcaccgacgccgctgcacggtggtgccgagcccatctgaggcgcttc
gtcctcaatcccagtcccgtcgcggcactggatgattcgatactggcactggccgacccg
ctggtcgtcaacgagatcgaggccgcctactacggcacagccgacgatctcgagcctctg
gcgcaacggcttcggtcacgctgcacgtcggcggtcatcaccctgggcgccgagggggtg
ctcgtcatcgacgacggtcgcgtcacccgcatcaacgtgcgcggagtcaccgccgtcgac
accaccggggccggcgacgtcttcgccggaaccctggtcgcgcacctcgccgccggcatc
gaacttcccgaggcggcgtcgctcgccgcggacaccgcaaccgatttcgtgtcccggtca
cgcaactga

DBGET integrated database retrieval system