KEGG   Gordonia polyisoprenivorans: GPOL_c48920Help
Entry
GPOL_c48920       CDS       T01719                                 

Definition
putative GMC (glucose-methanol-choline) oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    GPOL_c48920
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     GPOL_c48920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5513550..5515214)
Genome map
AA seq 554 aa AA seqDB search
MMDRRSFMRLTAAGVAAAGVSATVGAGRSAALPAAHGRYESLVPEIFRPVTPPRQHSEAI
VIGSGFGGSVSALRLAEAGIQTTVLERGSRWPHDPWRKIFGWDGRMLWHAQRSLAERSAS
SALTVPAYAETLGAMAAVDDFGGIFEISWHNNSAIMCGAAVGGGSVVYIGITAESKRDPF
NQVFKGVVDYDDMATTWYPKALAGLGATVVPPDVYRDHSFNNCRDFWRIGQKAGYAPYFV
PGNWRWNVVRDEIAGRAAPMATSSALANSNGSLNSLTYSYLPRAEATGKATIHPRHQVND
IHVELSGRFVLDVDYVSPYGDVLTRRTLTTDRLVLAAGCLGTNRLLVRARDTGTLPNLNE
HIGTGWGNNGNGNIDIAVGGSRKDQQSAVGAAGFFDTTEQFARVMVNSTFSLGPLDSAAA
AMNTSAIKMGITSVDPTRGTFRYHRDSQQVILDWPAGGNGGVAENCERIGHVMARHADFP
VDAVVYEPDLTWAHCMGGATLGTACDAYGRVHGYRNLYVNDGAMLPGSAGASNPSLTITP
VAERNIATIIADGG
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgatggatcgtcgatcgttcatgcggttgaccgctgccggagtcgcagctgccggcgtc
tcggcgaccgtcggtgcggggcgcagcgctgcgctacctgcggcacacggcagatacgaa
tcgctggtgccggagatctttcgtccggtcaccccgccccgtcaacactccgaggcgatc
gtcatcggctccgggttcggcggctcggtcagcgcacttcgactggcggaggccggaatt
cagacgaccgtgctcgaacgcggatcgcggtggccacacgacccgtggcgcaagatcttc
gggtgggacggccggatgctgtggcacgcccaacgatcccttgccgagcgatccgcgtcg
tcggcgctcacggtgcccgcctacgccgagaccctcggcgcgatggccgccgtcgacgac
ttcggcggaatcttcgagatcagctggcacaacaactcggcgatcatgtgcggtgcggcg
gtgggcggcggatcggtggtctacatcggcatcaccgccgagtccaagcgcgacccgttc
aaccaggtgttcaagggcgtcgtggactacgacgacatggccacgacctggtacccgaag
gctctggcgggcctcggggcgacggtcgtaccgccggacgtgtatcgcgatcacagcttc
aacaattgccgagacttctggcgcatcggccagaaagccggatatgcaccatatttcgtt
cccgggaactggcggtggaacgtcgtgcgagacgagatcgccggtcgcgccgcaccgatg
gccaccagcagcgcgctcgccaactccaatggctccctcaactcgctgacctacagctat
ctcccccgcgccgaggccaccggcaaagcgacaattcatccgcgccatcaagtcaatgac
atccacgtcgaactttctgggcggttcgtcctcgacgtcgactacgtcagcccgtacggc
gacgtcctcaccaggcgaaccctgacgaccgaccgtctcgtcctcgcagccggatgcctt
ggaaccaacagactgctggtgcgtgcccgcgacaccggaacattgccgaacctgaacgag
cacatcggaaccggctggggcaacaacggcaacggcaacatcgacatcgccgtcgggggc
agtcgtaaggatcagcagtcggccgtcggtgccgccggattcttcgacaccaccgagcag
ttcgcccgggtgatggtcaacagcaccttctctctcggaccactggattccgctgccgca
gcgatgaacacctcggcgatcaagatgggcatcacgtcggtcgatccgacccgcggaacc
tttcgctaccaccgagattcgcaacaggtcatcctcgactggccggccggtggcaacggc
ggcgtcgcggagaactgcgaacggatcggtcacgtgatggcgcggcacgccgacttcccg
gtcgatgcggtggtctacgagcccgacctgacctgggcgcactgcatgggcggagccacc
ctggggacggcgtgcgacgcctacggccgcgtccacggataccggaacctctacgtcaat
gacggcgccatgctgcccggttcggccggtgcgtccaacccgtcgctgaccatcaccccc
gtcgccgaacgcaacatcgccacgatcatcgccgacggcggctga

DBGET integrated database retrieval system