KEGG   Gordonia polyisoprenivorans: GPOL_c48920Help
Entry
GPOL_c48920       CDS       T01719                                 

Definition
(GenBank) putative GMC (glucose-methanol-choline) oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00984  Steroid degradation
gpo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    GPOL_c48920
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     GPOL_c48920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_binding_3 DAO GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AFA75886
UniProt: H6N214
Position
complement(5513550..5515214)
Genome map
AA seq 554 aa AA seqDB search
MMDRRSFMRLTAAGVAAAGVSATVGAGRSAALPAAHGRYESLVPEIFRPVTPPRQHSEAI
VIGSGFGGSVSALRLAEAGIQTTVLERGSRWPHDPWRKIFGWDGRMLWHAQRSLAERSAS
SALTVPAYAETLGAMAAVDDFGGIFEISWHNNSAIMCGAAVGGGSVVYIGITAESKRDPF
NQVFKGVVDYDDMATTWYPKALAGLGATVVPPDVYRDHSFNNCRDFWRIGQKAGYAPYFV
PGNWRWNVVRDEIAGRAAPMATSSALANSNGSLNSLTYSYLPRAEATGKATIHPRHQVND
IHVELSGRFVLDVDYVSPYGDVLTRRTLTTDRLVLAAGCLGTNRLLVRARDTGTLPNLNE
HIGTGWGNNGNGNIDIAVGGSRKDQQSAVGAAGFFDTTEQFARVMVNSTFSLGPLDSAAA
AMNTSAIKMGITSVDPTRGTFRYHRDSQQVILDWPAGGNGGVAENCERIGHVMARHADFP
VDAVVYEPDLTWAHCMGGATLGTACDAYGRVHGYRNLYVNDGAMLPGSAGASNPSLTITP
VAERNIATIIADGG
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgatggatcgtcgatcgttcatgcggttgaccgctgccggagtcgcagctgccggcgtc
tcggcgaccgtcggtgcggggcgcagcgctgcgctacctgcggcacacggcagatacgaa
tcgctggtgccggagatctttcgtccggtcaccccgccccgtcaacactccgaggcgatc
gtcatcggctccgggttcggcggctcggtcagcgcacttcgactggcggaggccggaatt
cagacgaccgtgctcgaacgcggatcgcggtggccacacgacccgtggcgcaagatcttc
gggtgggacggccggatgctgtggcacgcccaacgatcccttgccgagcgatccgcgtcg
tcggcgctcacggtgcccgcctacgccgagaccctcggcgcgatggccgccgtcgacgac
ttcggcggaatcttcgagatcagctggcacaacaactcggcgatcatgtgcggtgcggcg
gtgggcggcggatcggtggtctacatcggcatcaccgccgagtccaagcgcgacccgttc
aaccaggtgttcaagggcgtcgtggactacgacgacatggccacgacctggtacccgaag
gctctggcgggcctcggggcgacggtcgtaccgccggacgtgtatcgcgatcacagcttc
aacaattgccgagacttctggcgcatcggccagaaagccggatatgcaccatatttcgtt
cccgggaactggcggtggaacgtcgtgcgagacgagatcgccggtcgcgccgcaccgatg
gccaccagcagcgcgctcgccaactccaatggctccctcaactcgctgacctacagctat
ctcccccgcgccgaggccaccggcaaagcgacaattcatccgcgccatcaagtcaatgac
atccacgtcgaactttctgggcggttcgtcctcgacgtcgactacgtcagcccgtacggc
gacgtcctcaccaggcgaaccctgacgaccgaccgtctcgtcctcgcagccggatgcctt
ggaaccaacagactgctggtgcgtgcccgcgacaccggaacattgccgaacctgaacgag
cacatcggaaccggctggggcaacaacggcaacggcaacatcgacatcgccgtcgggggc
agtcgtaaggatcagcagtcggccgtcggtgccgccggattcttcgacaccaccgagcag
ttcgcccgggtgatggtcaacagcaccttctctctcggaccactggattccgctgccgca
gcgatgaacacctcggcgatcaagatgggcatcacgtcggtcgatccgacccgcggaacc
tttcgctaccaccgagattcgcaacaggtcatcctcgactggccggccggtggcaacggc
ggcgtcgcggagaactgcgaacggatcggtcacgtgatggcgcggcacgccgacttcccg
gtcgatgcggtggtctacgagcccgacctgacctgggcgcactgcatgggcggagccacc
ctggggacggcgtgcgacgcctacggccgcgtccacggataccggaacctctacgtcaat
gacggcgccatgctgcccggttcggccggtgcgtccaacccgtcgctgaccatcaccccc
gtcgccgaacgcaacatcgccacgatcatcgccgacggcggctga

DBGET integrated database retrieval system