KEGG   Gordonia polyisoprenivorans: GPOL_c49550Help
Entry
GPOL_c49550       CDS       T01719                                 

Definition
(GenBank) tryptophan synthase
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00260  Glycine, serine and threonine metabolism
gpo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01130  Biosynthesis of antibiotics
gpo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GPOL_c49550
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GPOL_c49550
Enzymes [BR:gpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GPOL_c49550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AFA75949
UniProt: H6N277
Position
complement(5583487..5584791)
Genome map
AA seq 434 aa AA seqDB search
MTTHVDATSPDLITVDVPTHWYNLAAELDEPIPPHLHPGTKEPVGPDDLAALFPAGLIAQ
EVSTEPYIEIPEPVREIYRMWRPSPLIRARRFEESLNTGARIYVKYEGVSPVGSHKTNSA
VAQAYYNSVDGVRKLTTETGAGQWGSALAFAGAQFGIDVEVWQVRASYDSKPYRGYLMRT
YGGTVHPSPSDLTEAGRAMLAKDPNTTGSLGMAVSEAVEVAATHDDTRYALGSVLNHVVL
HQSVIGQEAVEQLAGVEPGGADVVFGCAGGGSNLAGLSFPFLREKLAGRSNPRIVAAEPA
ACPSITQGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHAGGLRYHGMAPALSHTVELGL
VQGIAIAQRKAFEAGVQFARTQGIVPAPESTHAIAAAAAHVADDPTEQVVVIGLSGHGQL
DLPAYAEFLDGTMA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcacgtggatgccaccagcccggatctgatcaccgtggacgtgccgacgcac
tggtacaacctggcagccgagctcgacgagccgatcccgccgcacctgcacccgggcacc
aaggagccggtcggtcccgacgatctcgccgcgctcttcccggcagggctgatcgctcaa
gaggtgtcgaccgagccctacatcgagatccccgagccggtccgggagatctaccggatg
tggcggccgtcgccgctgattcgcgcgcgacggttcgaggagtcgctgaacaccggtgcg
cggatctatgtcaagtacgagggcgtcagcccggtcggcagtcacaagaccaattcggct
gtcgcgcaggcctattacaactccgtcgacggagtgcgcaagctgacgacagaaaccggg
gcaggccagtggggtagcgcgctggccttcgccggagcgcagttcggcatcgacgtcgaa
gtgtggcaggtgcgggcgtcctacgattccaagccgtaccgcggatatctgatgcggacc
tacggagggacggtgcacccgagtccgtccgacctcaccgaggccggccgcgcgatgctc
gccaaggacccgaacaccaccgggagcctgggcatggcggtcagtgaggccgtcgaggtc
gccgcgacccacgacgacacccggtacgcgctcggcagcgtcctcaatcacgttgtgctc
caccagagtgtcatcggccaggaggccgtcgagcagctcgccggcgtcgagccgggcggc
gccgacgtcgtcttcggttgcgccggaggcggatcgaacctcgccggtctctcgttcccg
ttcctgcgggagaagctggccggacggtcgaatccgcggatcgttgccgccgaacccgcc
gcctgcccgtcgatcacgcagggtgagtaccggtacgaccacggtgacgtcgccggactg
accccgctactcaagatgcacacgctcggtatggatttcgtgccggacccgatccatgcc
ggtggcctgcgctaccacggcatggcgcccgcgctgagccacaccgtcgaactcggactc
gtgcagggcatcgcgatcgcccagcgcaaggccttcgaggccggcgtccagttcgcgcgg
acccagggcatcgtgcccgcgccggagtcgacgcacgccatcgccgcagccgcggcccac
gtcgccgacgatcccacagagcaggtcgtcgtcatcggattgtcgggccacggtcagctc
gatctgcccgcgtacgcggagttcctcgacggcacgatggcctga

DBGET integrated database retrieval system