KEGG   Glaciecola psychrophila: C427_0334Help
Entry
C427_0334         CDS       T02535                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gps  Glaciecola psychrophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gps00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
324525..324890
Genome map
AA seq 121 aa AA seqDB search
MKGFGGRELLYDTLVTRGANVAEWEVYKRVKLDSPVFTEDWYPAQIRCIIATSGEVIQAA
FEYFEASWLTTLNWIVVSQRTADIASKLGVTQIDISRDASDQALIQCAQHVVKRARHFSE
H
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttttggcggtagagaattactttatgacaccctagttacccgaggggctaac
gtggcagagtgggaagtgtataaacgagttaaactagactctccggttttcacagaagac
tggtacccagcgcaaattcgttgcattattgctacaagtggtgaggttattcaagcagcc
tttgagtattttgaagcgagctggcttacgacattaaactggatagtggttagtcaacga
accgcagacatagcatctaaactgggtgtaacccagatagacattagccgtgatgcaagt
gatcaggcacttatacaatgcgcacagcacgtggttaaacgcgcaagacatttttcggag
cattaa

DBGET integrated database retrieval system