KEGG   Glaciecola psychrophila: C427_0856Help
Entry
C427_0856         CDS       T02535                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gps  Glaciecola psychrophila
Brite
Enzymes [BR:gps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     C427_0856
Secretion system [BR:gps02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   C427_0856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
791548..792279
Genome map
AA seq 243 aa AA seqDB search
MKNWTKIGLVLIGLVSTVSLKTFAAADTQNLDQVKAKLQAALGMQISSIGDAPVTGLLQV
MTEKGLFYTSQDGKYLLQARIYDIEEGMRNVTEEALGSVRLGGLAEFKDAVIEYKADKEK
YVVNIFTDITCGYCRKLHNEMEQYNDLGITVRYLAFPRGGINSSTYTDMVSIWCSDNKQE
AMDNAKAGGTVASKDCKTKVAEQYAFGQKIGVNGTPNIIMPDGSVIPGYQPPKQLEEALK
AIL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattggacgaaaattggcttggtacttattggtttggtcagtactgttagtctc
aaaacttttgcagcagcagatacacaaaaccttgatcaggtaaaagctaaactgcaagcg
gctcttggtatgcaaataagttctattggtgatgcgccggttaccggcctattgcaagtg
atgacagagaaagggttgttttataccagccaagatggcaagtatttgttgcaagctcgc
atttatgatatcgaagaaggtatgcgtaatgtgactgaagaagctcttggaagtgtgcgc
ttaggtggtttagcagaatttaaagacgctgttatcgaatacaaagcagataaagaaaaa
tatgtggtcaatatatttacagatattacctgtggttattgccgtaagttgcataatgaa
atggagcaatataacgatctgggtattactgttcgctatctagcctttcctcgtggtggt
attaatagttctacttacaccgatatggtttcgatttggtgctcggataataagcaagaa
gctatggataacgccaaagctggtggcacagtagccagtaaagactgcaaaacaaaagtc
gctgagcaatatgcttttggccaaaaaattggggtaaacggcacacctaatatcattatg
cctgatggctctgttattccgggttatcaaccacctaaacagcttgaagaagcgttaaaa
gccattctttaa

DBGET integrated database retrieval system