KEGG   Glaciecola psychrophila: C427_0895Help
Entry
C427_0895         CDS       T02535                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gps  Glaciecola psychrophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:gps00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    C427_0895
  Lipid metabolism
   00561 Glycerolipid metabolism
    C427_0895
   00600 Sphingolipid metabolism
    C427_0895
Enzymes [BR:gps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     C427_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(824210..826369)
Genome map
AA seq 719 aa AA seqDB search
MTNSPHNYISLTGRNSSLVIDCNNDAPQIMYWREKLSAQSTGQMMSTLRLRQEAPASPMK
EIRRSLTPTTGQGYTGHPGLSLHGETDQWSVLTEISKVECVAPNHYKITNIDTSRNLQVV
HTLNMDAETDVLAISTELKNNSNSAIHVDWCAAATFPIPSYFKHIIGFEGHWAGEFQEHH
LEQNFGSYVRENRRGRTSHDSFPGLIMRTKATDQLKGEAYGFHLGWSGNHKIIAEKMGDG
RAYVQMGELLLPGEIILQQGQTYSSPTLYASYTSKGLSALSQQYHQYVRKHLIRPSVKNK
PRPVHYNTWEGIYFNHDVTVLKDLATRAAAIGAERFVLDDGWFIGRDDDTAGLGDWYVDK
KYYPQGLTPLIDHVKAQGLEFGLWFEPEMVNPNSNLFRAHPDWILGTPPNPQVGFRNQLV
LDLSRQAVFDYLFERIHSLLAEYDISYIKWDMNRDLNHPGDANGKPAVHNQTRAFYQLLA
KLKSAHPKVEIESCASGGGRADYGVLAHTDRIWTSDSNDALERLKIQKGFSYFFPAELMG
SHVGPRDCHITHRNINMAMRASVTLFGHMGMEMDLRELTDEETVELKAMVQLYKKHRQLV
HSGDLFRLELPDYMHGLGIVAQDKSEALFSYSLIACSSASLPDQFHFAGLEKQAVYQLDI
VWPIKSGGCWPKASIFNFKTHLPDVDGKQFSGEVLMQLGMQLPLLTPQSSLIFHLNKVN
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattctccacacaactatatttcacttaccggacgtaacagcagcttagtcatc
gactgtaacaatgatgccccccaaattatgtactggcgcgaaaagctgtcagcacaaagc
actggccagatgatgagcacactgcgtttaaggcaagaagcacccgcttcacccatgaag
gaaatacgccgctctttaacacctacaacgggccaaggttataccggacatcctggtctt
agtttgcatggagaaacggatcaatggtcagtcttgactgaaatatcaaaagttgaatgt
gtagcgcctaatcactataaaatcaccaatatagataccagccgtaacctgcaagttgtg
catacccttaatatggatgcagagaccgacgtgctggcaatttcaacagagctgaaaaat
aacagcaatagcgctattcatgtggattggtgcgcggcggctaccttccctattccaagc
tattttaaacacatcattggatttgaaggacattgggcgggagaatttcaagagcatcat
ctagaacaaaactttggttcctacgtgcgagaaaaccgccgcggaagaacgtcccatgat
agcttcccaggacttatcatgcgcactaaagccactgaccaattaaaaggtgaagcctat
ggctttcatttaggctggagtggtaaccataaaattattgcagaaaaaatgggcgatgga
cgtgcctatgtgcaaatgggagaattattattacccggagaaattattttacaacaaggt
caaacctacagctctcctactctttacgccagttataccagtaaaggattatctgctctt
tcccagcaataccatcaatatgtgcgcaaacatttaattaggccgtcggtcaaaaacaaa
cctcgtccggtgcattacaatacatgggaaggcatttactttaatcacgatgtgacggtt
ctaaaagatttagctacccgtgcagcagctataggggcagaacgatttgtattagatgat
ggttggtttatcggccgtgatgatgacactgcaggtttaggcgattggtacgtagataaa
aagtactatccgcagggattaacgccactaatcgaccatgtaaaagcccaaggattagaa
tttggcctttggtttgaacctgaaatggttaaccccaatagtaatttatttcgtgcacac
ccagattggattttaggcacaccacccaatcctcaagtaggatttcgtaatcaattagtc
ttagatttaagccgccaagcagtattcgactacctgtttgaacgcattcatagtttgtta
gctgagtacgatatttcatacatcaaatgggatatgaaccgcgatctcaatcaccccggt
gacgcaaatggcaaacctgcggtacataatcaaacccgtgccttttatcagttgttagct
aaattaaaatcagctcacccaaaggtagaaattgaaagctgtgcatctggcggcggccgc
gcggattatggggtgttagcacacaccgatcgtatttggacctctgactcaaacgatgct
ttagaaagactcaaaatccaaaaaggtttttcgtactttttcccggctgagttaatgggc
tcccatgttggtcctagagactgtcatatcacccatagaaatatcaatatggctatgcga
gcgtcagttacgctgtttggtcatatgggcatggaaatggacttgcgagaattaactgac
gaagaaactgtcgagttaaaagcaatggttcagctgtataaaaaacaccgacaactggta
cattccggtgatttgttccggcttgaattgcctgactatatgcatggattaggcatagtc
gcacaagataaatcagaagcgctgttttcttatagcctgattgcttgtagttcggcgtct
ttacccgaccaattccattttgctggactagaaaagcaagcggtatatcaattagatatt
gtctggccaataaagtcaggtggttgctggcctaaagcctcaatatttaattttaaaaca
cacctacccgacgtggatggtaaacagttttcaggtgaagtgctgatgcaactgggtatg
caattacctttactgacaccacaaagtagcttaatttttcatttaaataaggttaattaa

DBGET integrated database retrieval system