KEGG   Glaciecola psychrophila: C427_1357Help
Entry
C427_1357         CDS       T02535                                 

Definition
alkaline phosphatase D domain-containing protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
gps  Glaciecola psychrophila
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C427_1357
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    C427_1357
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    C427_1357
Enzymes [BR:gps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     C427_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1272644..1273672
Genome map
AA seq 342 aa AA seqDB search
MKCITTCIFFLITINTTMAAKQVSDVPIKILFGSCLHQDKPQPIWQAMNQEQADLFVLLG
DNVYGDTEDMQELKAKYAKQWATSGMQTMLANTLTIGIWDDHDFGENDAGAEYPQKEASR
QIMLDYFNVPKDSPRRIRADGIYTSHILTQSNKKVQIILPDLRWNRSPLESVDKLHYMLS
KAPNDLGPYIPSKDEASTMLGETQWQWLEQQLQQPADVRVLATSLQFLPEFSGWESWANL
PHERQRFLALLDKYQIDNLVIVSGDTHWSEFSQIARNNQKLLWEMTASGLTEEWKNVSPN
QHRVGESYAKANYGVIELSGKQLTMSIKDVSGNTVMSHIIEL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtatcactacctgtattttctttttgataacaattaatacaacaatggcggct
aagcaggtatctgatgtgccgattaaaattctatttggctcatgtttacaccaagataag
ccgcaacctatctggcaagcgatgaaccaagagcaagccgatttgtttgtgttacttgga
gataatgtttacggtgataccgaagatatgcaggagttaaaagccaaatatgccaagcag
tgggcaacatcgggtatgcaaaccatgttggcgaataccctgactattggtatatgggat
gaccatgacttcggtgaaaatgatgctggtgcagaatacccacaaaaagaggcgtctcgg
cagatcatgcttgattattttaatgtgcctaaagatagcccaagacgcattagagcagat
ggtatctataccagtcatattttgactcaatccaataaaaaagtgcagattatattgccc
gacttgcgctggaatcgaagtcctcttgaatcagtagataagcttcattatatgctcagc
aaagcacctaatgatttaggaccttatatacccagcaaagatgaagcgtccactatgctt
ggcgaaacccaatggcaatggttagaacaacaattacaacaacctgcagatgtgcgcgtt
ttagcgactagtttacaatttctacctgagttttctggatgggaatcgtgggcaaactta
ccccatgaaagacaacggtttttagccttgctcgataaatatcaaatagataacctggtg
attgttagcggcgatactcattggagtgaattcagccaaatagcccgaaataaccaaaag
ttattgtgggaaatgacagcctctggccttactgaagaatggaaaaatgtcagccccaat
caacatagggtaggggagagttatgccaaggcaaactatggtgtgattgaactatcaggt
aaacaattaaccatgagcattaaagatgtatctggcaataccgttatgtcacacataatc
gaactataa

DBGET integrated database retrieval system