KEGG   Glaciecola psychrophila: C427_1482Help
Entry
C427_1482         CDS       T02535                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gps  Glaciecola psychrophila
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gps01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gps00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1386758..1387864
Genome map
AA seq 368 aa AA seqDB search
MNKLEWKRIVIKVGSALIAPHGKGCSSQYLISIAQFIMSCRAQGIEVVLVSSGSVAAGSH
LFPDELQQTIPIKKAMAAAGQAEMMATWDKLFDFSTAQMLLTRCDLRDRERYVSVRETIF
TLLEHDVLPIINENDTIVTDKLKVGDNDNLSAIVAAAADADALIICSDINGLYNKNPNKH
DDAVLIPNISEINADIFAMADGATSAVGTGGMITKVEAAQKATLHGIDTYIINGFTGSSF
TKLLNGENPGTHFSSDPSPMKEHLHWMTHTSTAQGEVIVEDDFTAKLDAHSEQLTSDDLV
EVKGEFAVGDTILVRRNDGTKLAKAKSNYSSCLLNFITNQEDKNFASDFQEQTGPIISDK
NVALLEAP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattagaatggaaacgtattgtcataaaagtcggaagtgcattgattgcgcct
catggaaagggctgtagtagccaatatctaattagtattgcgcaatttattatgagctgt
cgtgctcaaggcatcgaggtggtgttggtgtcatcaggttcggtagccgcaggatcacat
ttgttccctgatgagttacaacaaactattccaattaaaaaggctatggctgctgcgggt
caagcagagatgatggcgacatgggataaattgtttgatttctcaacagctcaaatgctc
ctaactcgttgcgatttgcgtgatagagagcgctatgtgagtgtcagagagacaatattc
actttgttagagcatgatgtgctgccgattattaacgaaaatgacaccatcgtgaccgac
aaattgaaagtaggggataatgataatttatctgcgattgtcgctgcggctgctgacgcg
gatgccttgattatttgttcagatattaacggtctgtataacaaaaatccaaataaacac
gatgatgctgttctgatcccgaatatttcagagattaatgcagatattttcgctatggca
gatggagcaacaagcgctgttgggacaggtggcatgataactaaggtagaagcggctcaa
aaagcgacgttgcatggtattgatacctatataataaatggttttactggatcgtcattt
accaagttgctgaacggcgaaaatccaggaacgcatttttcctcagatccctcgccaatg
aaagagcatttacattggatgacacacacatcgacggcccaaggtgaagtaatagtcgag
gatgactttactgccaaattagacgcacacagtgaacaactaactagcgatgacttagtc
gaggttaaaggagaatttgctgtaggtgatacgatattagtacgtagaaatgacggtaca
aagttggcaaaagccaaatctaactacagtagttgtttgttgaattttatcactaaccaa
gaagataaaaactttgctagtgattttcaggagcaaacgggacctattatttcagacaag
aacgttgctctgttggaggccccatga

DBGET integrated database retrieval system