KEGG   Glaciecola psychrophila: C427_1482Help
Entry
C427_1482         CDS       T02535                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gps  Glaciecola psychrophila
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C427_1482
  Amino acid metabolism
   00330 Arginine and proline metabolism
    C427_1482
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    C427_1482
Enzymes [BR:gps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     C427_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1386758..1387864
Genome map
AA seq 368 aa AA seqDB search
MNKLEWKRIVIKVGSALIAPHGKGCSSQYLISIAQFIMSCRAQGIEVVLVSSGSVAAGSH
LFPDELQQTIPIKKAMAAAGQAEMMATWDKLFDFSTAQMLLTRCDLRDRERYVSVRETIF
TLLEHDVLPIINENDTIVTDKLKVGDNDNLSAIVAAAADADALIICSDINGLYNKNPNKH
DDAVLIPNISEINADIFAMADGATSAVGTGGMITKVEAAQKATLHGIDTYIINGFTGSSF
TKLLNGENPGTHFSSDPSPMKEHLHWMTHTSTAQGEVIVEDDFTAKLDAHSEQLTSDDLV
EVKGEFAVGDTILVRRNDGTKLAKAKSNYSSCLLNFITNQEDKNFASDFQEQTGPIISDK
NVALLEAP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattagaatggaaacgtattgtcataaaagtcggaagtgcattgattgcgcct
catggaaagggctgtagtagccaatatctaattagtattgcgcaatttattatgagctgt
cgtgctcaaggcatcgaggtggtgttggtgtcatcaggttcggtagccgcaggatcacat
ttgttccctgatgagttacaacaaactattccaattaaaaaggctatggctgctgcgggt
caagcagagatgatggcgacatgggataaattgtttgatttctcaacagctcaaatgctc
ctaactcgttgcgatttgcgtgatagagagcgctatgtgagtgtcagagagacaatattc
actttgttagagcatgatgtgctgccgattattaacgaaaatgacaccatcgtgaccgac
aaattgaaagtaggggataatgataatttatctgcgattgtcgctgcggctgctgacgcg
gatgccttgattatttgttcagatattaacggtctgtataacaaaaatccaaataaacac
gatgatgctgttctgatcccgaatatttcagagattaatgcagatattttcgctatggca
gatggagcaacaagcgctgttgggacaggtggcatgataactaaggtagaagcggctcaa
aaagcgacgttgcatggtattgatacctatataataaatggttttactggatcgtcattt
accaagttgctgaacggcgaaaatccaggaacgcatttttcctcagatccctcgccaatg
aaagagcatttacattggatgacacacacatcgacggcccaaggtgaagtaatagtcgag
gatgactttactgccaaattagacgcacacagtgaacaactaactagcgatgacttagtc
gaggttaaaggagaatttgctgtaggtgatacgatattagtacgtagaaatgacggtaca
aagttggcaaaagccaaatctaactacagtagttgtttgttgaattttatcactaaccaa
gaagataaaaactttgctagtgattttcaggagcaaacgggacctattatttcagacaag
aacgttgctctgttggaggccccatga

DBGET integrated database retrieval system