KEGG   Glaciecola psychrophila: C427_1858Help
Entry
C427_1858         CDS       T02535                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gps  Glaciecola psychrophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C427_1858 (malQ)
Enzymes [BR:gps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     C427_1858 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1752045..1753025
Genome map
AA seq 326 aa AA seqDB search
MLIGLYRDLAVGVSEGSAEIWGNKELYCTDASVGAPPDILGPLGQTWGLPPMDPEKLYEQ
QYQPIIELFDANMRATGALRIDHVMALLRLWWVVKGDSAKEGGYVYYPVDDLLAILALES
HRHQSLVIGEDLGTVPDEIRTKLADNGVYSYRVFFFEQAPDGGFFSPAHYPEQSMSTLTT
HDMPTLTGYWHCDDLVLGKELGLYPTEEILSTLYTSRHENKQSILDTLHGHHSINDEVGR
DVHNVDMSKALNFGMQLHMAGGSSALLSLQLEDWLEMDKPVNIPGTFKEYPNWQRKLTRN
LQDIFNDSSLNQLAANLTEARLQASK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttgattggcttataccgcgatttggcggtgggtgtcagtgaaggtagcgcagaaatt
tggggcaataaagaactgtactgcacagacgcaagcgtaggcgctcctccagatatatta
ggcccattaggacaaacttgggggttgccccccatggatcctgaaaaactctacgaacaa
cagtatcagcctattattgaattatttgatgccaatatgcgggccactggtgcgttacga
attgatcacgtgatggcattattgagattatggtgggtggtcaagggtgatagtgccaaa
gaaggcggctatgtgtattatccggtggatgatctattggctattttagcgttagaaagt
cacaggcaccaaagtttggtgattggtgaagacttaggtactgtacctgatgaaataagg
actaaattagcagacaatggcgtgtattcttatcgggtgttcttttttgaacaagcacca
gacggcgggtttttctcgcctgctcattatcctgaacaatctatgtcgaccctcaccacc
catgatatgcctaccttaacgggttactggcattgtgatgatttggtattaggtaaagaa
ttggggttgtatcccactgaagaaattttaagtactttatataccagtagacatgaaaac
aagcagtccattttagatactttacatggccatcattcgattaatgacgaggtgggtcgt
gacgtgcataatgtggatatgagtaaagcgttaaactttggaatgcagctacatatggcc
ggtggttcaagtgcgctgttaagcttacagttagaagattggttagaaatggataaacca
gttaatattcctggtacgtttaaagaatatccgaactggcaacgtaagttaacacgcaat
ttgcaagacatttttaatgacagttcattaaatcaactagcggcaaatttaaccgaggca
cgactacaggcctctaagtaa

DBGET integrated database retrieval system