KEGG   Glaciecola psychrophila: C427_1859Help
Entry
C427_1859         CDS       T02535                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gps  Glaciecola psychrophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:gps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C427_1859
Enzymes [BR:gps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     C427_1859
Exosome [BR:gps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C427_1859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1753074..1755266
Genome map
AA seq 730 aa AA seqDB search
MQLEQALKQAKCTFPFAHLGAHYQTSNSVFTVTTWLPNAEEVNVIDLASGKLLGILKKVN
GSHLFRGEFEVKQAPQFYAFDVTNKQGQYQVVDPYQFQDQAYHAVHFIDHNAQNVYQQLG
AQLIELDVELEAPIQATRFAVFAPNATAVSLIGEFNYWDGSCLPMQKTDFGYWVLVVPGI
EAGAKYKYQLKDAAGNDLPHKADPVGFYAEQYPSHTSIVFDHELYQWKDKAWLKKAKKDK
YHQPMSIYELHLASWKRPAADSGETYLSYRELAAQLIPYIKDMGYTHIEMLPVSEFPFDG
SWGYQPVGLFAPSSRFGTPDDFKFFVDQCHQNDISVIIDWVPAHFPEDGHGLARFDGTHV
YEYEDPRKGWHPDWNSCIYDFGKDTVRQFLVANALFWIDKYHIDGLRVDAVASMLYLDYS
REEGEWIPNVDGGNHNYEAISFLQWMNTEVYEKFPHAMTIAEESTSFPKVSRPVSEGGLG
FGFKWNMGWMHDSLHYIAKDPSYRRYHHNEITFSMVYAFDESFVLPISHDEVVHGKGSLL
RKMPGDEWQQAANLRTYTGFMYAHPGKKLNFMGNEIGQAAEWNHDSSVNWHLLEFEKHQG
IQNLYRDLNKAYRKYPALYELDHSPDGFEWIDHGNADQSILSILRKSTDAKQKIYVLINF
TPVVHENFKLGVQSGGEYQLILNSDDKKYWGSASKTNKKMYAVTEPWNDQPYSVSVNLPP
LACLFILFKG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcgaacaagcactaaaacaagccaaatgcacttttcctttcgctcatctgggt
gctcattatcagacctcaaactcggttttcactgtcacaacttggttgcctaatgctgaa
gaagtcaatgtcattgacttagcgtcgggtaagctgctcggtattttaaaaaaggtaaat
ggcagtcatttatttcgaggtgagtttgaggttaaacaagcgccgcagttttacgcattt
gatgtaaccaataaacaagggcaatatcaggttgttgatccttatcagtttcaagatcaa
gcttatcatgcggtacattttatcgatcacaatgcacaaaacgtatatcaacaactaggt
gcacaacttattgagctggatgtggaattagaagcacccattcaagcaactcgttttgcg
gtgtttgcacccaatgccactgctgtttccctgattggtgagtttaattattgggatggc
tcatgtttacctatgcaaaaaaccgattttggttattgggtattagttgtgccgggcata
gaagctggggccaaatacaaataccaacttaaggatgctgcgggtaatgacttgcctcac
aaagcagatccagtcggcttttatgctgagcaatatccttcacacacttctatcgttttc
gaccacgaactatatcaatggaaagataaagcatggcttaaaaaggctaagaaagataaa
taccatcagccgatgagtatttatgaattgcacttagcgtcatggaaacgaccagcggct
gattctggggaaacctacttgagttatcgagaattagcagcacaattaattccctacatt
aaagatatgggttatacccacattgaaatgttacctgtttctgagtttccttttgacggc
tcttggggctatcaaccggttggtttgtttgcacctagtagtcggtttggtacgcccgat
gacttcaagttttttgtcgaccaatgtcaccaaaatgatataagtgtgattattgattgg
gtgcctgctcatttccccgaggatggtcatgggttggcaaggtttgatggcacccatgtt
tacgaatatgaggaccctcgcaaaggttggcatccagattggaattcgtgcatttacgat
tttggtaaggatacggtgcgtcaatttttggtggccaatgcgttgttttggatagacaaa
tatcatattgatgggctacgtgttgatgctgtggcttctatgttgtacttggattattcc
cgagaagagggggaatggatccccaacgtagacggtggtaaccacaattacgaagccatt
agttttctgcaatggatgaacacagaagtatacgaaaaatttccccatgccatgactatc
gctgaggagtctacttcgtttcctaaagtttcacggccagtatctgaaggtggtttaggc
tttgggtttaaatggaatatgggctggatgcacgattcgttgcattatattgctaaagat
ccgtcataccgtcgttaccaccacaacgaaatcactttttctatggtgtatgcatttgac
gaaagttttgtgctgcctatttctcatgacgaagtggttcacggtaaaggctcgttactt
cgtaagatgccaggtgacgaatggcaacaagcggctaacttacgtacttatactggattt
atgtatgctcatcctggtaaaaaacttaactttatggggaatgaaataggtcaagctgct
gaatggaatcatgacagctcggttaattggcatttgcttgagttcgaaaaacatcaaggt
atccagaacttgtatcgtgacttgaacaaggcgtaccgcaaatatcctgcactatatgaa
ttagatcacagtcctgatggctttgaatggattgatcatggcaatgctgatcaaagtatt
ttgtctatattgcgtaagtccactgatgccaagcaaaaaatttatgtgttgattaatttc
actcccgtggttcacgaaaactttaagttaggggtgcagagtggaggtgagtatcaactt
attttgaactcagatgataaaaagtattggggaagcgccagcaaaacgaataaaaaaatg
tatgcggtcaccgagccttggaacgaccaaccttattctgtcagcgttaatctgccccct
ttggcatgtttgtttattttatttaagggctaa

DBGET integrated database retrieval system