KEGG   Glaciecola psychrophila: C427_2130Help
Entry
C427_2130         CDS       T02535                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
gps  Glaciecola psychrophila
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C427_2130
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    C427_2130
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    C427_2130
Enzymes [BR:gps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     C427_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2025467..2027158
Genome map
AA seq 563 aa AA seqDB search
MTQLSRRHFLKSSGLAASCIAISTAITGCVTDTIHTKLSNVKFEHGVASGDPSSSAVIIW
TRVQPSEKDNTAQIMWELASDRDFTQVFRTGIVTTQRNQDFTVKIDVQQLKPATEYYYRF
ISANNTSQTGRTLTLPINNVDKIKLVVVSCSNYPAGYFNAYDHAAQLEEIDAVLHLGDYI
YEYPMGGYATEKAAEIGRALAADNDKEIISLDDYRKRYAIYRTDKGLQALHAAAPFIVVW
DDHEVCNDTYKNGAQNHNEGEGDFFVRRAAAIQAYYEWLPIRPPYGEQKPEIYRSFDFGN
LLSLHMLDTRVIGRDKQLSYNDYRDPVTKELDIKQFSQDLYQSDRTLLGKEQMTWLQKNV
SQSSSQWQMLGQQVLMAKMLIPVEVFAGGEIANTPARLAALKTLKNTLDAGATLTSEQQQ
RLASVMPYNLDAWDGYPKEREDLYDLFSAQNKRLVVVAGDTHNAWHSELKDKAGNVVGVE
FATPGITSPGMEKYLKLTNDNAQVVAENLSSLIAELEYCNLHQRGYMVVTITPESASAKW
NFVDNILSDEYRVIDTHQASYQA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgacccaactttctcgccgtcacttcctcaaatcgtcaggtcttgcagctagctgtatt
gctatttctaccgctattactggatgtgtaactgacaccattcacacaaaactttctaat
gttaaatttgaacacggtgtagcgagtggagaccccagtagtagcgctgtcattatttgg
acgcgtgttcagccttcagaaaaagacaataccgctcaaataatgtgggaacttgccagt
gatcgtgatttcactcaagtgtttcgcacaggcattgtcaccacacaacgtaatcaggac
tttaccgtcaaaattgatgtgcaacagttaaagcctgcaaccgaatattactatcgtttt
atcagcgcaaataacaccagtcaaaccggtcgcacactcacgttacccattaacaatgta
gacaaaattaaactggttgtagtgtcatgttctaattatcctgctggatactttaacgct
tacgaccatgcggcacagttagaagagattgatgctgtactgcatttaggcgattatatt
tatgaatatcctatgggggggtacgccaccgaaaaagctgctgaaattggacgcgcttta
gcagcagataacgataaagaaattatcagtctagacgattaccgaaagcgttatgccatt
tatcgtactgataaaggattacaagctttacacgctgcagcgccgtttattgtggtgtgg
gatgatcatgaggtttgcaacgacacatataaaaacggagcccaaaatcataatgagggt
gaaggagatttttttgtaagacgtgctgctgctattcaagcttattatgagtggttacct
attcgtcctccatatggtgaacaaaaacccgaaatataccgcagtttcgactttggaaac
ttgctcagcttgcacatgttagacacccgcgttattggccgtgataaacaattaagttac
aacgactatagagaccccgtaaccaaagagttagacataaaacaattttcacaagattta
taccagtcagatagaacgcttctggggaaagaacaaatgacttggttgcaaaaaaacgtg
agtcaatcaagcagccaatggcaaatgcttggtcaacaagtattgatggccaaaatgctg
attccggtagaagtatttgcaggtggtgaaattgccaataccccggcgcgccttgctgcc
ttaaaaaccctcaaaaacacccttgacgcgggggctacacttacttcagaacaacaacaa
cgattagcgtctgtgatgccatataatcttgacgcatgggatggttatcctaaagagcga
gaagatctttacgatttatttagcgctcaaaacaaacgattagtggtcgttgctggcgat
actcataatgcttggcacagtgagttgaaagataaagcaggaaacgttgtaggtgtagaa
tttgccactccaggtatcacttcacctggtatggaaaaatacctaaaactgactaatgac
aatgcgcaagtagtcgctgaaaatcttagcagcctaattgctgaacttgaatattgtaac
ttacatcagcgaggctatatggttgtgactattacgcctgagagcgctagtgctaaatgg
aatttcgtggacaatatattgtctgacgaataccgtgtgatagatacgcatcaagccagt
tatcaggcttag

DBGET integrated database retrieval system