KEGG   Glaciecola psychrophila: C427_3016Help
Entry
C427_3016         CDS       T02535                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
gps  Glaciecola psychrophila
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gps00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2866310..2868067
Genome map
AA seq 585 aa AA seqDB search
MLSVLEQLIERVEHHLAVIYQDVELITTYPELCKQLLETMRIDNSDLLVEPKRHHNNWDQ
QDVMLITYGDSIEKSGEKPLHSLHDFLTKYCGDAINSVHLLPFFPYSSDDGFSVIDYSSV
NEALGDWDDIRAITTDYRVMSDVVINHCSSRSAWFENFIKGEGPGSDFFYTASLKDDLSK
VVRPRTSDLLRLTETPHGEKQVWCTFSHDQVDFDFRNPAVLDTFVSIMRQYLDTGIRIFR
LDAVAFLWKKIGTSCINLEQTHEVVRLLRTLIEHAVSDAVIITETNIPNRQNLTYFGNAN
EAHGIYNFSLPPLLVNTLVTGSCKHLKSWLGSMPPSQNGTFFFNFIASHDGIGLRPAEGL
LQDHELTALVNTMQNFGGRISWRTSEDGKQKAYEINIALYDALQGTVKGTDKWGLDRFIC
AHSIMFGLEGIPGIYIHSLLGTGNDYEKVKNTSHNRSINRHKWDYTKLQEQLALPFSQHS
KVHARMIKLLNIRKEQPAFHPSATQFTLQLGEQIFGFWRQSMDRRQSIFCIFNITDEPQS
IRLSDMNLIGTDTWFDLISGHTMCLEDLEYRLAPYQSMWISNIGS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgttttagaacaattgatagaacgtgttgagcatcacttagccgttatatat
caggatgttgaattaattactacgtaccctgagttatgtaaacagttattagaaactatg
cgcatagataactctgatttattggtagagccgaaacgccatcataacaattgggatcaa
caggatgtcatgctaatcacctatggcgatagcattgaaaagtcgggagaaaaaccactt
cactctttacacgattttttaactaagtattgcggtgacgcgattaacagcgtacatctt
ttaccttttttcccatacagctctgatgatgggttttcggtcattgattattctagtgtt
aacgaagcgttaggagactgggatgatataagagcgataactacagattatcgggttatg
tctgatgtggtaattaatcattgctcatctagaagtgcatggtttgaaaactttatcaaa
ggtgaaggcccgggtagtgactttttttatactgcctctttaaaagatgatttatctaaa
gtggtacgacccagaacgtctgatttgctaaggttaaccgaaacaccgcacggagaaaag
caggtctggtgtacttttagtcatgatcaagtcgatttcgatttcagaaacccagcagtt
ttagacacgtttgtttcaatcatgaggcaatatttggacaccggcattcgaatatttcgg
ttagatgccgtggcttttctctggaaaaaaataggcacaagctgtataaatcttgaacaa
acccacgaagtggtgcgtttattgcggacactaatagaacacgcagtgagtgacgcggtc
atcatcactgaaaccaatattcccaatagacaaaaccttacctattttggtaatgccaat
gaagcacacggtatttataacttttcgctacccccgctgttagtcaacaccttagtaaca
ggttcttgcaaacaccttaagtcgtggttgggcagtatgcccccctcacaaaatggcacc
ttctttttcaattttatcgcgtctcatgatggaataggattgaggcctgctgaaggccta
ttgcaggatcacgaactcacagctctggttaatactatgcaaaattttggtggtagaatt
tcatggcgaacgtctgaagatggcaaacaaaaagcttatgaaataaatattgctctctat
gatgcactgcaaggtacagtaaaaggtactgataaatgggggctagacagatttatatgt
gctcacagcatcatgtttggtcttgagggtattccagggatttatatacatagtttatta
ggcaccggcaatgactatgaaaaagttaaaaataccagccataaccgttctattaatcgg
cataaatgggactacaccaaattacaggagcagctagctttacccttcagccaacatagc
aaagtacatgcgaggatgataaagctactcaatatccgtaaagagcagcccgcttttcac
cctagtgccacccagtttacgttgcaattaggcgaacaaatatttggtttttggcgtcaa
agtatggaccgaagacaaagtattttttgtattttcaatatcactgatgaaccacaaagc
attaggttaagtgacatgaacttaatagggaccgacacttggtttgatcttatcagcggc
catacaatgtgtctggaagatttggaataccggttggcaccttatcaatctatgtggata
tctaatattggcagttag

DBGET integrated database retrieval system