KEGG   Glaciecola psychrophila: C427_4152Help
Entry
C427_4152         CDS       T02535                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
gps  Glaciecola psychrophila
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:gps01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gps00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4007475..4009073
Genome map
AA seq 532 aa AA seqDB search
MSQYQNDVKQIAELRSTKAGAWNAINPDYAARMKAQNRFKTGLDIAKYTAAIMRKDMQEY
DADSSQYTQSLGCWHGFIGQQKMLSVKKHQGTTDKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVASLIEELYTFLRQADARELGDLFRQLDDAKQNGGDTAAIQNAIDNYETHVVPII
ADIDAGFGNEEATYLLAKKLIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDDGVIVARTDSLGAGLTQKIPVSQKAGDLAAQYNAFLDASEVTSIDDLVD
GDSVLKQDGKLVKPVRLPNGLYKFKENTGFDRVVLDCITSLQNGADLLWIETEKPHVGQI
GDMVRAIRTEIPNAKLVYNNSPSFNWTLNFRQQIFDIWSEAGKDLSQYKRDELMSVKFDD
TDLALEADEKIRTFQADAAREAGIFHHLITLPTYHTAALSTDDLAKGYFGDQGMLAYVKG
VQRREIRQGLACVKHQAMAGSNMGDDHKEYFSGEQALKASGEDNTMNQFDAE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatatcagaatgatgttaaacagattgcagaactaagatcaaccaaagcagga
gcttggaacgcaattaacccagattatgctgctcgtatgaaagctcaaaatcgctttaaa
actgggttggatattgcaaaatataccgcagctatcatgcgtaaagatatgcaggaatat
gatgctgactcaagccagtacactcaatcactaggttgctggcacggatttattggacaa
cagaaaatgttgtccgtaaaaaaacatcaaggtaccactgataaaagctatttataccta
tctggatggatggttgcggcattacgttcagagttcggtccccttcccgaccagtcaatg
cacgaaaagacctcagtagcatcattaatagaagaactatatacattcttacgccaagcc
gatgcccgtgaactaggtgatttatttagacagctagatgacgctaaacaaaacggtggc
gatactgctgcaatacaaaacgctattgataattatgaaactcatgttgtaccaattatt
gctgatattgatgcaggatttggtaatgaagaagcaacgtatttgcttgctaaaaaactt
atcgaagccggagcttgttgtatacagatagaaaaccaagtatctgacgctaaacaatgt
ggtcatcaggatggtaaagttaccgttccacacgaagacttcctagccaaaatcaacgca
gtacgttacgcatttttagagttaggcgtagatgacggtgtgatagttgcccgtaccgac
tctttaggtgctggattaactcaaaaaatacctgtatcacagaaagcaggtgatttggcc
gctcagtacaatgcattcttggatgcgagtgaagtgacctctatagatgatttagtagat
ggcgattctgttcttaaacaagatggcaaactagtaaaaccggtacgtttaccgaatgga
ttatacaaatttaaagaaaacactggttttgaccgtgtagtactagattgcatcacttca
ttgcaaaatggtgcagacttattgtggattgaaacagaaaaaccacacgttggtcaaatt
ggcgatatggtgcgagctattagaaccgaaattcctaacgcgaagttggtttataacaat
tcaccctctttcaactggaccttgaacttccgccagcaaatctttgatatctggtcagaa
gccggtaaagacttaagccaatacaaaagagacgaattgatgtcggttaaatttgacgac
actgatttggcccttgaagcggatgaaaaaatccgaactttccaagcagatgctgccaga
gaagcaggtattttccatcacttaattactttacctacttatcatacagcagcgttgtct
actgatgatctagccaaaggttactttggtgaccaaggtatgttggcatatgttaaaggt
gtgcagcgtagagaaattagacaaggtcttgcatgtgttaaacaccaagcgatggctggc
tctaatatgggtgatgaccataaagaatacttttctggtgaacaagcgcttaaagcatca
ggtgaagataatactatgaaccagttcgacgccgaataa

DBGET integrated database retrieval system