KEGG   Paraglaciecola psychrophila: C427_4336Help
Entry
C427_4336         CDS       T02535                                 

Definition
(RefSeq) DNA ligase
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gps  Paraglaciecola psychrophila
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:gps00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    C427_4336
   03410 Base excision repair
    C427_4336
   03420 Nucleotide excision repair
    C427_4336
   03430 Mismatch repair
    C427_4336
Enzymes [BR:gps01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C427_4336
    6.5.1.6  DNA ligase (ATP or NAD+)
     C427_4336
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     C427_4336
DNA replication proteins [BR:gps03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    Other elongation factors
     C427_4336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4191661..4192605
Genome map
AA seq 314 aa AA seqDB search
MSSPIPLSGLLIIVLLSNASGFCFANELSPSQTKKIYVSQQLANVYQDDITVQDYWISEK
LDGIRARWNGSALVTRNANIIYAPAWFVKDFPPQTLDGELWLARNSFEKTASIVLRKTPN
SDWQNITFMLFDLPENTGTFSQRLIKMQLLVDAVTSPYLQVIPQFKLANQKQLMLKLDTL
VAQGAEGLMLNHHGAYYEDGRSANLLKLKKHQDAEARVIAHNSGKGKYKNMMGSMLVELI
ELGESDRGLQFKIGSGFSDMQRQSPPSIGTIITFKYYGLTARGIPRFASFLRIKPTVLDK
KAVMTKSNIQKTYY
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcctatacccctctctggtttgttgattattgtattgttgtctaatgcttct
gggttttgttttgccaatgagctcagcccatctcaaactaaaaaaatatatgtctcccaa
caattagccaatgtgtaccaggatgacataacggtacaagattactggatcagcgaaaaa
ctagatggcatacgcgcccgctggaatggttctgcactggttacacgcaatgctaatatt
atttacgcaccagcctggtttgtgaaagattttccgccgcaaactttagatggcgagtta
tggttagcccgcaacagctttgagaaaaccgcttctattgtgttacgcaaaacgccgaac
tcagactggcaaaacattacattcatgttgtttgatttacctgaaaacacggggactttt
agtcagcgtttaattaagatgcagcttttagttgatgcggttaccagcccttatttacag
gtgatccctcaattcaaactggcgaatcaaaaacaactgatgctcaagttagatacatta
gtcgcacaaggcgcagaaggcctaatgttgaatcatcatggtgcttactatgaggatggt
agaagcgcaaatttgcttaaattaaaaaagcatcaagatgccgaagctagagtgatcgcg
cataattcagggaaaggtaaatacaaaaacatgatggggtcaatgctggttgagctgatt
gagttgggtgagtctgacagaggcctacaatttaaaattggctcagggttttctgatatg
cagcgccagtcgccaccatcaataggcacaataattaccttcaagtattacggccttacg
gcaagaggtattccacgatttgcgagttttttacggattaaacctacagttttggataaa
aaagcagtaatgactaaaagcaacatacaaaaaacatattactga

DBGET integrated database retrieval system